CAZyme Information: MGYG000001831_01683

Basic Information

• Species: TF01-11 sp000436755
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; TF01-11; TF01-11 sp000436755
• CAZyme ID: MGYG000001831_01683
• CAZy Family: GT1
• CAZyme Description: PGL/p-HBAD biosynthesis rhamnosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386		43873.9	8.5086

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001831	3856267	MAG	Denmark	Europe

• Gene Location: Start: 9915; End: 11075 Strand: -

Full Sequence      

MRRVMFFPSPPNSGSMGSAIKCIGIAKELRSRGNEVAFVMGGSVADLIMREHFRVYQSPI
PVAKMDIRDINSANDFFDWTGMTEYSFLRMSVKAEVEAIYNFKPDVLFSETRLSTPISAH
ITGVPLISIASWPCSPDFPLNVQTKGRNLKKVNELLEQYNMTPIESLTELIYRRSDIKLA
PTIPLLEPELQYEEDIIYTGYLLDLKYRKEDIPPWLEKTKKDSRIFIYPSVGAMFPELYT
KVFKETFEGGKYQVICACGYHKSLKYLPANTEWVKFVHYIPPPAVLERSILVIFHGGQDS
MLSTLLYGIPSIVVPGRHFEREYNANNLVRTGAAMKLPVYGFRKNRLLSAIDEVLSGSYR
DKSRELSLTLKSYGGVGRCIDIIESI

Enzyme Prediction     

No EC number prediction in MGYG000001831_01683.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	87	385	2.1e-23	0.7591623036649214

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1819	YjiC	8.47e-30	1	384	1	396	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
cd03784	GT1_Gtf-like	1.14e-26	3	384	2	402	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
cd03785	GT28_MurG	1.38e-10	14	374	8	339	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam04101	Glyco_tran_28_C	8.63e-10	230	364	8	150	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.
COG0707	MurG	3.67e-05	25	335	20	302	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ94838.1	3.06e-119	44	385	1	342
AWV33186.1	1.98e-109	3	369	5	380
AIQ73839.1	1.98e-109	3	369	5	380
AVT40941.1	1.59e-47	4	384	6	377
AVT32037.1	9.18e-46	4	384	6	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KQW_A	1.79e-14	12	385	10	383	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
6KQX_A	1.84e-14	12	385	10	383	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168],7BOV_A Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
4AMB_A	1.15e-09	3	332	24	345	Crystalstructure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AMB_B Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater]
4AMG_A	1.15e-09	3	332	24	345	Crystalstructure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AMG_B Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AN4_A Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AN4_B Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AN4_C Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AN4_D Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A5U6W6	6.56e-14	88	367	108	406	PGL/p-HBAD biosynthesis glycosyltransferase MRA_2985 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) OX=419947 GN=MRA_2985 PE=3 SV=1
P9WFR0	6.56e-14	88	367	108	406	PGL/p-HBAD biosynthesis glycosyltransferase MT3034 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3034 PE=3 SV=1
P9WFR1	6.56e-14	88	367	108	406	PGL/p-HBAD biosynthesis glycosyltransferase Rv2958c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2958c PE=1 SV=1
O34539	1.01e-13	12	385	10	383	NDP-glycosyltransferase YjiC OS=Bacillus subtilis (strain 168) OX=224308 GN=yjiC PE=1 SV=1
A1KMV6	1.26e-13	59	367	88	417	PGL/p-HBAD biosynthesis rhamnosyltransferase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) OX=410289 GN=BCG_2983c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001831_01683.