CAZyme Information: MGYG000001831_02195

Basic Information

• Species: TF01-11 sp000436755
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; TF01-11; TF01-11 sp000436755
• CAZyme ID: MGYG000001831_02195
• CAZy Family: GT11
• CAZyme Description: O-antigen biosynthesis glycosyltransferase WbnK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
287	MGYG000001831_40|CGC1	33948.58	6.8225

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001831	3856267	MAG	Denmark	Europe

• Gene Location: Start: 5423; End: 6286 Strand: +

Full Sequence      

MIIIEVAGGLGNQMFQYALYQKYLHMGKLAKLDLFSYENPKSMPFELDLFHLPYDVDTKK
ERNGYMDQKRLTVCRILDQISGKPKHSYYAEKLDVGYQPEILNFENTYLSGYWQCEKYFI
DFRQEVLDLFQFPDQQINLASRNLQEQMRREQAVAVHVRRGDYLLPENSRKYGNICTLQY
YKNAMQYMKKKVPDAKFYFFSNDSEWVRKNLANGDSVIVDCNHGKENYLDMYLMSQCSHN
IIANSSFSWWGAWLNQNPDKIVISPQRWFSHLDASDAICEDWVRVNG

Enzyme Prediction     

No EC number prediction in MGYG000001831_02195.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	1	284	6.6e-77	0.9927536231884058

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	4.42e-68	1	269	1	256	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	3.69e-29	1	268	32	278	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.
cd11548	NodZ_like	0.002	1	258	1	284	Alpha 1,6-fucosyltransferase similar to Bradyrhizobium NodZ. Bradyrhizobium NodZ is an alpha 1,6-fucosyltransferase involved in the biosynthesis of the nodulation factor, a lipo-chitooligosaccharide formed by three-to-six beta-1,4-linked N-acetyl-d-glucosamine (GlcNAc) residues and a fatty acid acyl group attached to the nitrogen atom at the non-reducing end. NodZ transfers L-fucose from the GDP-beta-L-fucose donor to the reducing residue of the chitin oligosaccharide backbone, before the attachment of a fatty acid group. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
cd11296	O-FucT_like	0.008	122	250	41	196	GDP-fucose protein O-fucosyltransferase and related proteins. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNX52916.1	1.65e-73	1	285	1	287
AKF24141.1	3.26e-63	1	285	1	291
ADL35250.1	2.47e-61	1	263	1	276
AFK06870.1	8.50e-60	1	287	1	288
QCZ24143.1	2.33e-59	1	285	1	287

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58YV9	7.90e-37	6	285	5	302	O-antigen biosynthesis glycosyltransferase WbnK OS=Escherichia coli OX=562 GN=wbnK PE=1 SV=1
Q866E8	1.05e-09	154	286	216	354	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Sapajus apella OX=9515 GN=FUT1 PE=3 SV=1
Q866C9	1.42e-09	154	286	216	354	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Lagothrix lagotricha OX=9519 GN=FUT1 PE=3 SV=1
Q866F1	1.42e-09	154	286	216	354	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Saimiri sciureus OX=9521 GN=FUT1 PE=3 SV=1
Q866C7	1.42e-09	154	286	216	354	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Ateles belzebuth OX=9507 GN=FUT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001831_02195.