CAZyme Information: MGYG000001832_00668

Basic Information

• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Bilophila
• CAZyme ID: MGYG000001832_00668
• CAZy Family: GH103
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
316		34468.26	8.5494

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001832	3017752	MAG	Denmark	Europe

• Gene Location: Start: 13743; End: 14693 Strand: +

Full Sequence      

MLFVLLGTGCASQETSPSLEQSAVFPSYQGSYASAPIPAEWIPLYQRLRADGLDGPDLPR
YFSMMGTPSQDPMGRKIKELYTKAFAPKPKPTPSAKPSKPRPKVYPGVITAENVEKCRAF
LAENAAAFDFAERTYGVPREIAVSLLFVETRLGTFLGKEKAFYTLASMASSRQPDDISSY
LDRLPGASGRLGWIQERMEQRSDWAYKEFVALLGNVRASHLDALGVPGSVYGAIGLCQFM
PSNIAPYGADGDGDGTVNLFTVPDAVASLSNYLAMHGWNKASTRAARHKVIKTYNRIDIY
ANTILGLAEAQGYRAD

Enzyme Prediction     

No EC number prediction in MGYG000001832_00668.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH103	98	283	4.7e-44	0.5389830508474577

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13406	SLT_2	7.30e-47	105	314	54	239	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.
COG2951	MltB	8.12e-32	87	285	77	248	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
TIGR02283	MltB_2	7.22e-28	108	280	58	204	lytic murein transglycosylase. Members of this family are closely related to the MltB family lytic murein transglycosylases described by TIGR02282 and are likewise all proteobacterial, although that family and this one form clearly distinct clades. Several species have one member of each family. Many members of this family (unlike the MltB family) contain an additional C-terminal domain, a putative peptidoglycan binding domain (pfam01471), not included in region described by this model. Many sequences appear to contain N-terminal lipoprotein attachment sites, as does E. coli MltB in TIGR02282. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
PRK10760	PRK10760	5.02e-24	2	287	12	272	murein hydrolase B; Provisional
cd13399	Slt35-like	1.93e-19	228	310	24	108	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADP85790.1	5.31e-105	8	309	24	328
AAS95158.1	5.31e-105	8	309	24	328
ABM29301.1	7.53e-105	8	309	24	328
ATD81641.1	2.54e-96	27	309	98	375
SPD34368.1	2.54e-96	27	309	98	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1LTM_A	2.44e-18	109	280	81	226	AcceleratedX-ray Structure Elucidation Of A 36 Kda Muramidase/transglycosylase Using Warp [Escherichia coli]
1D0K_A	2.49e-18	109	280	83	228	ChainA, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1D0L_A Chain A, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1D0M_A Chain A, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1QDR_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QDT_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QUS_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QUT_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli]
5O8X_A	9.93e-18	106	278	58	205	TheX-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa],5O8X_B The X-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
4ANR_A	1.20e-17	106	278	75	222	Crystalstructure of soluble lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5ANZ_A	7.17e-10	103	278	98	247	CrystalStructure of SltB3 from Pseudomonas aeruginosa. [Pseudomonas aeruginosa],5AO7_A Crystal Structure of SltB3 from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P41052	2.00e-17	109	280	122	267	Membrane-bound lytic murein transglycosylase B OS=Escherichia coli (strain K12) OX=83333 GN=mltB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000399	0.017512	0.982063	0.000014	0.000022	0.000014

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001832_00668.