CAZyme Information: MGYG000001833_00410

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; CAG-274; UMGS1441
• CAZyme ID: MGYG000001833_00410
• CAZy Family: PL9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
689	MGYG000001833_8|CGC1	74029.08	4.536

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001833	2107204	MAG	Denmark	Europe

• Gene Location: Start: 31977; End: 34046 Strand: +

Full Sequence      

MNNIKRVLSFITALIMCISIVSVNAYAETGVVLKNTVWTMSSHGATTSNITADFEWKNLN
IKATAAKYISFDSAYMKTQGAANVISFKAAGPCTITVTAKSNSTTTDRYAVVSDRNGTQI
GTDITAPMSGDGTGKVEYTGYGEEISITPKGGGISIKSIAVEYKNTNNLKGDINGDGKVD
AADAAMLLKYVMGKDNINDDTALSAANGNNDGVINVLDANWILNNVYEPTSETTTVEIID
TSDGVEVRNYSELASALANAGAKAYVMNDIEMNDQVKLSLGEQSIIGVPDENGVLPVLNF
ENMTGKNDVINGKSSDGDAGVRILSANNVVKNLVIEKAHDNGILMKEVGTTGNLIENCIL
RYNNDSGVQITKGACGNVMKGIYSYRNCDVFTLGGNADGFAIKLSAGPELTTDSSVMDAN
KNTFTECYSWENSDDGWDSFDYPLNQQDASFQTAGGRWTYRNDYTNCIAWNNGTAANCFG
YNDYINSLTLDENLPIIMRFKALSDEATYNNFVSQYNAGTLCSRTASASTYYSKLDTIFG
AIPTVNGSLKASQISNSTNWQGNPNGFKLGSAYTQSNSERYMTNCITFDHLAAGFDKNNS
GAKIYAENCIAFGNKINYNLSGYTAYKWNKVFGWSGTSGNGKPSGASGVTVAINDGSSKE
ETVRAAAERITGYAEGNRMIYSNVFENVF

Enzyme Prediction     

No EC number prediction in MGYG000001833_00410.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL9	256	476	1.5e-30	0.48663101604278075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14256	Dockerin_I	2.68e-14	170	224	1	54	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
pfam00404	Dockerin_1	2.71e-09	171	226	1	55	Dockerin type I repeat. The dockerin repeat is the binding partner of the cohesin domain pfam00963. The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome. The dockerin repeats, each bearing homology to the EF-hand calcium-binding loop bind calcium.
cd14254	Dockerin_II	2.34e-05	171	226	1	53	Type II dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type II dockerins, which are responsible for mediating attachment of the cellulosome complex to the bacterial cell wall.
cd14253	Dockerin	5.55e-05	171	223	1	52	Dockerin repeat domain. Dockerins are modules in the cellulosome complex that often anchor catalytic subunits by binding to cohesin domains of scaffolding proteins. Three types of dockerins and their corresponding cohesin have been described in the literature. This alignment models two consecutive dockerin repeats, the functional unit.
cd14252	Dockerin_like	5.56e-05	171	218	1	48	Dockerin repeat domains and domains resembling dockerin repeats. Dockerins are modules in the cellulosome complex that often anchor catalytic subunits by binding to cohesin domains of scaffolding proteins. Three types of dockerins and their corresponding cohesin have been described in the literature. This alignment models two consecutive dockerin repeats, the functional unit.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBZ48778.1	3.96e-66	47	689	65	606
BAK28435.1	3.96e-66	47	689	65	606
QKI00169.1	3.96e-66	47	689	65	606
QWX86240.1	3.96e-66	47	689	65	606
CBI14069.1	1.46e-65	47	689	65	606

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RU4_A	3.57e-06	365	476	151	241	ChainA, Pectate lyase [Dickeya chrysanthemi]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000253	0.999065	0.000196	0.000169	0.000154	0.000143

TMHMM  Annotations     

start	end
7	26