CAZyme Information: MGYG000001834_00009

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; UBA1242; UMGS2070
• CAZyme ID: MGYG000001834_00009
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354		38833.48	10.3643

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001834	945128	MAG	Denmark	Europe

• Gene Location: Start: 31238; End: 32302 Strand: +

Full Sequence      

MKNCIVLTGGGTAGHVMPHFALLDSLKQNYSKIVYIGSKNGVEKEIVKNKANLDFYGIDA
VKFVRGKILVNLLLPVKLIKAKHQAKKYLKTTKPNIIFSKGGFVSVPVVLAAKSLKIPVV
CHESDLSMGLANKICSKYAKCVCTTFEKTSHLKSNNGVFTGTPLISQAKNLDAINQTKKR
LGILPNLKVLLVTGGSLGSVAINKAVFSAINTLTKNYYVIHITGKGNKNNNLNLKNYTQI
EFASNMPELIDIADIVVSRAGSNTIFELAHALKPMLLIPLPKGTSRGDQVENANYFKDNH
FANVLYQENLSPTTLVEMINTTNNEKANLIKHLKNSGFKNGTKQVLEQIYKYSL

Enzyme Prediction     

No EC number prediction in MGYG000001834_00009.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	190	331	5.3e-38	0.9044585987261147

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	8.42e-113	5	351	4	353	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	2.83e-95	5	329	2	328	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	3.37e-91	5	349	3	351	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
PRK12446	PRK12446	3.99e-81	5	349	4	349	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed
TIGR01133	murG	7.27e-79	5	349	3	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAT40569.1	1.55e-89	5	354	4	354
QLY82283.1	9.37e-89	5	349	6	351
ACD52855.1	1.93e-88	2	351	3	353
AJF28779.1	1.93e-88	2	351	3	353
AJF31840.1	1.93e-88	2	351	3	353

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D1I_A	1.53e-33	5	326	12	337	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
3S2U_A	1.25e-26	1	319	1	318	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	1.59e-25	5	279	9	281	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2V1X5	3.87e-89	2	351	3	353	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium botulinum (strain Alaska E43 / Type E3) OX=508767 GN=murG PE=3 SV=1
B2TLE0	3.40e-87	2	351	3	353	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium botulinum (strain Eklund 17B / Type B) OX=935198 GN=murG PE=3 SV=1
Q893R7	4.96e-87	1	352	1	353	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium tetani (strain Massachusetts / E88) OX=212717 GN=murG PE=3 SV=2
Q0SRB4	5.44e-86	2	351	3	353	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=murG PE=3 SV=1
Q8XIQ1	7.69e-86	2	351	3	353	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001834_00009.