CAZyme Information: MGYG000001835_00039

Basic Information

• Species: Phocaeicola sp000432735
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp000432735
• CAZyme ID: MGYG000001835_00039
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
857	MGYG000001835_1|CGC1	98794.52	5.6704

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001835	3299974	MAG	Denmark	Europe

• Gene Location: Start: 44228; End: 46801 Strand: +

Full Sequence      

MWKIILAVLWTGLFSLGNTALADSLTLHSNWQFSKYGSDEWLPATVPGTVHQDLMALGKL
PDPFYGMNEKEIQWVEDEDWLYRTSFVLSEEQLAHQEIFLVFDGLDTYADVSLNGACILK
ADNMFVGYRVPVKQVLRSGENKLLIRFRSPIREAMPQWKTNGFIYPAANDHRAERVSIFT
RKAPYSYGWDWGIRMVTCGIWRPVRLEFANQAEIDDYFVCQQSVTSDWAEVDNRLEIRNL
GNEIREAQVKVTYAYGQEESRSVEQTVRLQPGLNTVSLPLTIESPHLWMPNGWGEAALYD
FRASVCMDGETVASQQHRIGLRSIRVVNEEDSLGMSFYFEVNGIPMFAKGTNLIPSDALL
PRVTRERYVRLLEDVQAANMNMIRVWGGGVYEDDALYEEADKRGILVWQDFMFACTPYPH
DPAFLKQVSEEVVYNIKRLRNHASLAMWCGNNEVGEGMKYWGWKRKYGPEIYQQLADGYD
ILFRKLLPEKVKELDPGRFYLESSPYEANWGRPESWKRGDSHNWGTWYGQKPFESLDTEI
PRFMSEFGFQSFPEMKTIHSFATPEDYDMESPVMNAHQKSSIGNFLIKKAMGLYYPVPEK
FEDLVYLGLVLQGHGMRQGMEAHRRNRPYCMGSLIWQLNDSWPVVSWSAIDYFGNWKALH
YQSRRAFAPVLVDAIREGDKLRYYVMSDVLKTKDVVLQMELMNFKGKVLRRHQVEGKLPV
NSSVVFYEEDWNQAFAACDTTTSFIHMTLKDRHGREILSDEVYYPALPKSQHLPQAKISC
KMKKKNGAYELTLKSDQLARDVFIEIPVQGVRFSDNFFDLLPGVSRKILVTSGDGCALED
LTVNIRQLGDICSIEHE

Enzyme Prediction     

EC	3.2.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	23	721	2.8e-108	0.6821808510638298

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	9.95e-106	26	829	14	783	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17786	Mannosidase_ig	1.49e-18	679	769	1	90	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam17753	Ig_mannosidase	2.12e-18	775	846	1	72	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
PRK10340	ebgA	4.55e-16	23	457	72	453	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	5.01e-13	214	322	3	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VTZ55415.1	0.0	13	851	7	849
VDS02457.1	0.0	13	851	7	849
VTZ55469.1	0.0	36	851	2	817
VDS02701.1	0.0	36	851	2	817
VTZ55172.1	0.0	36	851	2	817

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	0.0	22	848	6	834	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	0.0	22	856	8	844	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	0.0	22	856	6	842	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	0.0	22	848	8	836	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	0.0	22	848	6	834	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1CGA8	2.68e-127	20	830	2	828	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
Q0CCA0	2.04e-125	26	831	8	827	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
Q4WAH4	3.00e-125	27	830	9	828	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
A1D911	8.25e-125	27	830	9	828	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
B0YBU9	1.16e-124	27	830	9	828	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000267	0.999054	0.000184	0.000160	0.000152	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001835_00039.