CAZyme Information: MGYG000001835_00868

Basic Information

• Species: Phocaeicola sp000432735
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp000432735
• CAZyme ID: MGYG000001835_00868
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395	MGYG000001835_8|CGC1	45706.57	9.7995

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001835	3299974	MAG	Denmark	Europe

• Gene Location: Start: 14032; End: 15219 Strand: -

Full Sequence      

MYRFYYKIHNMITLDFASTTFLLAATCGILCIIQLCYVFGIYNRIHQLFKKGNEPSATDL
PPLSVIIVTKDSGSALNQNLPAILEQDYPKFEVIVINDKSAGEDEDILKLLSDRYENLYH
TFIPKTARYVSRKKLGIAMGIRASRYDWIVVTEPYCHPVSKNWLRSLAAQMPPNTDIVLG
YSNYLPKKGWFARRIITDSFFHSLRYLGMALAGHPYMGVGCNLAYRKSLYEKHKGFADHL
QLQRGEDDLFINAVANKYNTRVASGPDSIVRMPVPPYKRIWFERKMNALVTGHYYRGMAR
ISNAFETWTCGLFHLATIGALAMSIVEQQWIVTGIVVLLWLLRFISVMMVFRRTAHDLNE
NLCCIFPLFDLLRPLWSLVRQIQYLLRKKRDFLRK

Enzyme Prediction     

No EC number prediction in MGYG000001835_00868.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04192	GT_2_like_e	1.85e-49	65	285	1	224	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd02525	Succinoglycan_BP_ExoA	4.63e-14	64	270	3	205	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
cd06423	CESA_like	1.02e-13	65	239	1	175	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
pfam00535	Glycos_transf_2	2.08e-11	64	230	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	1.35e-10	65	191	1	124	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY36192.1	5.31e-190	11	395	1	385
QRO25358.1	3.75e-186	23	395	13	388
QJR60444.1	1.49e-131	28	395	15	385
QJR73297.1	1.49e-131	28	395	15	385
ALA75640.1	1.49e-131	28	395	15	385

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5U4S8	1.11e-06	41	257	31	246	Ceramide glucosyltransferase-B OS=Xenopus laevis OX=8355 GN=ugcg-b PE=2 SV=1
Q5BL38	2.61e-06	41	257	31	246	Ceramide glucosyltransferase OS=Xenopus tropicalis OX=8364 GN=ugcg PE=2 SV=1
Q16739	4.61e-06	41	257	31	246	Ceramide glucosyltransferase OS=Homo sapiens OX=9606 GN=UGCG PE=1 SV=1
Q8AY29	4.61e-06	41	257	31	246	Ceramide glucosyltransferase-A OS=Xenopus laevis OX=8355 GN=ugcg-a PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	42
304	326
330	347