CAZyme Information: MGYG000001835_01966

Basic Information

• Species: Phocaeicola sp000432735
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp000432735
• CAZyme ID: MGYG000001835_01966
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
856	MGYG000001835_28|CGC2	97285.25	5.4481

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001835	3299974	MAG	Denmark	Europe

• Gene Location: Start: 15806; End: 18376 Strand: +

Full Sequence      

MKMTYYKKSLVAGAICALACSNLLAQEAEFDLSSQRLEIQQVLPVPGKKIDHQGIIINPT
PHKLTVDRNNMLDMTSGLVLKDKQDKFSQDLGFLTLAKKGVKLTIDFGKKAALKQGVKEV
SGAYAMHIDKKGISIVGYDERGAFYGIQTLRQLMESPIAQNKQLPYLDINDYPDLPNRGV
VEGFYGTPWSHQVRMSLIDFYGKFKMNTYLYGPKDDPFHSCPNWRLPYPEKEAQNIKELV
EACKRNRVDFVWAIHPGQDIKWNEEDYQNLVNKFNWMYDLGVRDFAIFFDDISGEGTNPV
KQTELLNRLTDEFVKVKGDVSPLTVCPTDYSKLWANPTPQGSLAIYGNTLNPDIKIFWTG
DVVCSDLTPETMEWINSRIKRPAYYWWNYPVQDYVRNFILQGPAYGLDTSLTKDDVCGVI
SNPMEHGEASKLALYGVADYAWNIANYNPIDNWERGLNELAPEAKDAYRTFAIHSCDTEN
GYRRDESWETKTFRIADWNDAAAQALKAEFEKIEKVPAEMEQGCENKALLQELRPWLVEF
GKLGTRGKHTIELGQIFRSGKSDADFWSKYIQNLMSKEDRKNYEAHKSGTLKLQPFYENA
MDDMSHEFLKKLLGSTPKDYKGIGSFGNSGTILTKLMLDNDTTTFYTSGIGQKDGDWIGV
DLRDVRDVTEVSILQGRNSVDDVDYFDHAILECSADGKTWTPLIGELTKQYVINWKGDAI
KARYVRLKRLDSERKNYASVRSFDVNPLHAENLGFKLEAENPQQAVYAFDQNLSTSYQVA
QSISFEVPQGVKAYTLLMNELSSPLKIKQFDKKGNLLSETTVSSPYFKLELTNDKVTKVS
LEGKAEIFEVIADSLQ

Enzyme Prediction     

No EC number prediction in MGYG000001835_01966.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	178	472	6.4e-107	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	3.29e-168	178	471	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam02838	Glyco_hydro_20b	2.50e-13	59	171	6	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
pfam00754	F5_F8_type_C	1.46e-09	638	728	18	111	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	5.65e-06	643	727	34	126	Substituted updates: Jan 31, 2002
smart00231	FA58C	2.23e-04	648	736	37	130	Coagulation factor 5/8 C-terminal domain, discoidin domain. Cell surface-attached carbohydrate-binding domain, present in eukaryotes and assumed to have horizontally transferred to eubacterial genomes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALB75783.1	0.0	1	852	1	851
BCI62100.1	0.0	1	851	1	852
ADV43394.1	0.0	6	853	3	849
AHF11939.1	0.0	7	851	5	852
BBL05673.1	0.0	3	852	1	845

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2J47_A	3.99e-154	53	570	1	528	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with a imidazole-pugnac hybrid inhibitor [Bacteroides thetaiotaomicron VPI-5482],2W4X_A BtGH84 in complex with STZ [Bacteroides thetaiotaomicron VPI-5482],2W66_A BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W66_B BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W67_A BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2W67_B BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2WCA_A BtGH84 in complex with n-butyl pugnac [Bacteroides thetaiotaomicron VPI-5482],2XJ7_A BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XJ7_B BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XM1_A BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM1_B BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM2_A BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],2XM2_B BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],4UR9_A Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],4UR9_B Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],5FKY_A Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FKY_B Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FL0_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL0_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron]
2CHO_A	3.99e-154	53	570	1	528	Bacteroidesthetaiotaomicron hexosaminidase with O-GlcNAcase activity [Bacteroides thetaiotaomicron VPI-5482],2CHO_B Bacteroides thetaiotaomicron hexosaminidase with O-GlcNAcase activity [Bacteroides thetaiotaomicron VPI-5482]
7K41_A	4.37e-154	53	570	4	531	ChainA, O-GlcNAcase BT_4395 [Escherichia coli K-12]
2VVN_A	7.46e-154	53	570	22	549	BtGH84in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVN_B BtGH84 in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVS_A BtGH84 structure in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],2X0H_A BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],2X0H_B BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],4AIS_A A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],4AIS_B A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],7OU8_AAA Chain AAA, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482],7OU8_BBB Chain BBB, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482]
5MI4_A	1.55e-153	54	570	13	539	BtGH84mutant with covalent modification by MA3 [Bacteroides thetaiotaomicron VPI-5482],5MI5_A BtGH84 mutant with covalent modification by MA3 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],5MI6_A BtGH84 mutant with covalent modification by MA3 in complex with Thiamet G [Bacteroides thetaiotaomicron VPI-5482],5MI7_A BtGH84 mutant with covalent modification by MA4 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZI2	4.08e-153	53	570	22	549	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q0TR53	7.68e-90	124	533	133	546	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	5.31e-89	124	533	133	546	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
P26831	5.65e-46	133	754	143	803	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
Q8VIJ5	1.54e-34	179	450	63	339	Protein O-GlcNAcase OS=Rattus norvegicus OX=10116 GN=Oga PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000838	0.580790	0.417453	0.000316	0.000300	0.000280

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001835_01966.