CAZyme Information: MGYG000001835_02592

Basic Information

• Species: Phocaeicola sp000432735
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp000432735
• CAZyme ID: MGYG000001835_02592
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
155		17996.54	9.5203

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001835	3299974	MAG	Denmark	Europe

• Gene Location: Start: 14553; End: 15020 Strand: +

Full Sequence      

MAKDTLTVGPGNQKKLDDNSQNSDRKTSLKTELQKKTDDITKSENNLPELTIPNLYKEII
RNGILYPKIVLAQAILETGWFRSSVCRNKHNLFGLTNPRTGKYYEFNHWTESVRAYYTKV
QYKYKGGNYLLWLDEIGYAEDPDYIIAVIRILKTL

Enzyme Prediction     

No EC number prediction in MGYG000001835_02592.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	56	154	4.8e-17	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01832	Glucosaminidase	2.13e-16	53	117	2	78	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	6.52e-11	65	153	28	137	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
COG1705	FlgJ	2.05e-09	61	150	60	180	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	1.96e-07	71	95	186	210	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
PRK08581	PRK08581	7.74e-04	13	107	280	383	amidase domain-containing protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT57866.1	1.01e-94	1	155	1	155
AKA52216.1	1.43e-93	1	155	57	211
QJR77087.1	4.60e-92	1	155	57	211
ALJ41751.1	4.60e-92	1	155	57	211
QUT98797.1	5.53e-91	1	155	57	211

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000015	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001835_02592.