CAZyme Information: MGYG000001837_01164

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA737
• CAZyme ID: MGYG000001837_01164
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
493	MGYG000001837_46|CGC1	56606.33	6.8809

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001837	1602907	MAG	Denmark	Europe

• Gene Location: Start: 9740; End: 11221 Strand: +

Full Sequence      

MPSRDKRLKRYSGVLCAVSSLPSKYGIGTFGESAYRFIDFLRDAGQCFWQILPLNPLGEG
NSPYKSVSCFAGEPLYIDLDFLVRDGLLSADEIGEYKASDAVDYKRVKKFKIPLLIKAAE
NFDTNSRGYKNFLKQNDSWLNGYSTFAAALDIYKTHKITDLPDGIKYQLPDDLKKFKEKH
SSEILFHKIMQYFFYCQYFELKAYANKNGVKIIGDIPFYVSPDSADVWENPDDFKVGRDF
TPTEVAGVPPDIFSSSGQLWGNPIYNWQNMRRNEYRWWQSRLLFCKDLYDVLRIDHFRAF
ADYYSIPYGSPTAASGSWQKGEGIAFWNKMTQKIGDINIIAEDLGGEDDAEVISLLKHTD
FPNMKILQFGFTGDIQNNFLPQNYGYNCVCYTGTHDNDTTLGWYKSIDRKQRIMFDMLVK
DFNIEVSHRMIRAAVKSPAMLCIIPMQDLLCLDSSARMNTPGTSHGNWQWQMKSDDISAD
TATLLKRLTKERN

Enzyme Prediction     

No EC number prediction in MGYG000001837_01164.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	18	487	2.6e-151	0.979757085020243

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14508	PRK14508	0.0	7	490	2	492	4-alpha-glucanotransferase; Provisional
pfam02446	Glyco_hydro_77	0.0	18	473	3	458	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
PLN02635	PLN02635	8.86e-165	1	489	20	521	disproportionating enzyme
COG1640	MalQ	6.93e-142	4	493	8	517	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
TIGR00217	malQ	2.43e-122	8	493	12	512	4-alpha-glucanotransferase. This enzyme is known as amylomaltase and disproportionating enzyme. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJA09593.1	4.06e-150	10	490	2	488
QNM02360.1	7.12e-147	10	490	2	493
CEI74091.1	2.51e-146	10	490	2	488
ADL12364.1	5.37e-146	9	489	4	490
QNK42602.1	5.92e-146	10	489	2	486

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6M6T_A	4.16e-122	9	489	4	491	ChainA, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_B Chain B, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_C Chain C, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_D Chain D, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_E Chain E, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_F Chain F, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_G Chain G, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_H Chain H, 4-alpha-glucanotransferase [Streptococcus agalactiae]
5CPQ_A	2.56e-114	1	488	61	554	Disproportionatingenzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPQ_B Disproportionating enzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPS_A Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPS_B Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPT_A Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CPT_B Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CQ1_A Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CQ1_B Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CSU_A Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSU_B Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSY_A Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana],5CSY_B Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana]
1TZ7_A	7.92e-113	10	475	22	486	Aquifexaeolicus amylomaltase [Aquifex aeolicus],1TZ7_B Aquifex aeolicus amylomaltase [Aquifex aeolicus]
1X1N_A	1.40e-112	1	484	17	514	Structuredetermination and refinement at 1.8 A resolution of Disproportionating Enzyme from Potato [Solanum tuberosum],6LX1_A Potato D-enzyme complexed with Acarbose [Solanum tuberosum],6LX2_A Potato D-enzyme complexed with CA26 [Solanum tuberosum]
7COV_A	6.31e-112	1	484	69	566	PotatoD-enzyme, native (substrate free) [Solanum tuberosum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0A3Q1	1.23e-134	9	490	3	498	4-alpha-glucanotransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=malQ PE=3 SV=1
P0A3Q0	1.23e-134	9	490	3	498	4-alpha-glucanotransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=malQ PE=3 SV=1
Q59266	2.51e-132	18	490	3	481	4-alpha-glucanotransferase OS=Clostridium butyricum OX=1492 GN=malQ PE=1 SV=1
P72785	7.71e-116	9	478	4	483	4-alpha-glucanotransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=malQ PE=3 SV=1
Q9LV91	1.98e-113	1	488	73	566	4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic OS=Arabidopsis thaliana OX=3702 GN=DPE1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001837_01164.