CAZyme Information: MGYG000001837_01185

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA737
• CAZyme ID: MGYG000001837_01185
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
930		106242.49	5.309

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001837	1602907	MAG	Denmark	Europe

• Gene Location: Start: 7796; End: 10588 Strand: -

Full Sequence      

MRDEKSSEFIKELYSDADNAPDITVCPDSVCDIAQLIPYEQLAPIRKKIFDFEGEYAVLQ
FNPQKPADEDEGLLKVINRLISQNMKVVLLPLGYTHNDDGVLRDFNNKYGNLCHIIDKKL
NVFEIAAMLAGCSIYIGSSFHGSITSIAYGKTAISYNYISPRTKNAEIFRMYGVGDFVAE
NAAQVYDILDGYFNGESVFSPDVKTVTCEVEKHFDKIFDTINSNGCKEFDFEDFFATLTE
LLPKCTMLETRVNNYIEAAEMTDKNVKNLENILNENNKTISALTDELEDTKKQLSVAEQQ
KSEINANYINAIHSYNSILNSFFWKLTSPFRKVSQKFKDILVKNKCLLSCAIYAKGFLKG
GFKGGKRQLENYRKEIESNSRFCSTITKKVRKEQENFKFSKNIKFSILVPLYNTPENFLV
DMIKSVQDQTYKNWELCLADGSTTEFSYVEKVCKDIAKTDVRIKYKKLTENKGISENTNE
CIKMSTGDYIALFDHDDILHPSALFECMKQICDNGADYVYTDEATFLGDDINHLISIHYK
PDFSYYNLLANNYICHFSVFSAKLIDKAGMFRSRYDGSQDHDIILRLTDVAEKIIHIPKI
LYFWRSHANSVAMDINSKKYAIEAGQNAVHDFLLSKGIESKVTSSPAFPAIYRIEYEIKD
QPLVSIIIATKNNRKDLVETVTSIKENITYTNYEIIITDNGSTNEDVKSYYNDLKNDDKI
KVLHCDFNTNSSKIINFAVSECTGDYLLLLHDDTKIITPNFVEEMLMYAQKDDVGAVGAK
LYFKNKSVQHAGYVLNLGNDRIAGHSHREINSENLGYMGKLFYAQNIMAVSSACLMVKKS
KYYEAGGFDESLAVAYNDVDFCLKLDEIGYKNIFNPFCEMYHYEHGKDLIKEGDYSEDIV
NFKKKWQDKLSAGDPYYNPNFSLDYSYVIE

Enzyme Prediction     

No EC number prediction in MGYG000001837_01185.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	665	842	2.5e-24	0.9705882352941176
GT2	406	520	5.7e-24	0.6588235294117647

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	1.27e-79	404	605	2	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	7.02e-26	666	884	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	5.13e-23	665	842	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
pfam00535	Glycos_transf_2	1.26e-22	406	565	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1216	GT2	1.23e-21	662	884	3	221	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAB1243278.1	6.93e-212	229	924	330	1026
QUO22278.1	1.15e-209	315	926	18	624
AOZ95572.1	2.06e-190	316	926	39	669
QNM02106.1	1.69e-189	289	926	19	673
ADL33299.1	4.31e-189	387	926	100	667

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	3.28e-11	406	537	8	135	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	4.61e-98	406	924	369	891	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.41e-59	398	923	314	833	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
A0A0H2URH7	6.08e-11	404	678	6	306	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1
P71054	1.15e-09	404	504	6	104	Putative glycosyltransferase EpsE OS=Bacillus subtilis (strain 168) OX=224308 GN=epsE PE=2 SV=2
P77414	2.81e-09	402	622	4	244	Putative colanic acid biosynthesis glycosyl transferase WcaA OS=Escherichia coli (strain K12) OX=83333 GN=wcaA PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001837_01185.