CAZyme Information: MGYG000001837_01209

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA737
• CAZyme ID: MGYG000001837_01209
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
535		61799.29	5.0467

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001837	1602907	MAG	Denmark	Europe

• Gene Location: Start: 7813; End: 9420 Strand: +

Full Sequence      

MKIRTPDYIGIYTENGSDNYSFSECIKKDDIKVGIFLKNELLHIELTADQTPVKYISLRW
NFTSFEKRNEIVKVYGDAWERAYGDLEWRGIVPDRMMPWVCAVSNGSDQNRDFTGRRTEC
FGVKTQPCAMCMWQYDTNGLTLWLDVRCGGRGVILQKRTLEVCDVLFGDYSDISAFDALK
TYYKRLCDNPLTVDHKVYGTNNWYYAYGETSHDEILEDTRLLMKCCAELENKPYIVLDDG
WQKNACDAPWNILREGKFYDMKLLADEMSAMGARPGIWVRPLSDQKFEVVDIDSDMRSKC
NNKYLDASHPDVLGYVADLIKMICDWGYTLIKHDFSTYDMLGFWGFERPKEFAKDGWAFY
NRNKTTAEIILDFYRVIYEASAGRAIVLGCNVIGHLAAGLVHINRTGDDTSGMEWERVRK
YGVNALAFRMLHNEAFFLSDADCVGIMGKIDWNLNREWLSAVSHSGTPLFVSPKPNVMSE
SQLQELKEAYKVNSFQNDVLVPLDWMENVTPEKWLLNGQEKQFNWYEKTGIKAFN

Enzyme Prediction     

No EC number prediction in MGYG000001837_01209.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	170	412	5.6e-16	0.3648255813953488

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	3.86e-34	201	491	7	298	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
COG3345	GalA	7.07e-10	182	352	278	462	Alpha-galactosidase [Carbohydrate transport and metabolism].
pfam02065	Melibiase	0.001	201	334	46	190	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd06592	GH31_NET37	0.002	235	281	37	80	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
cd14792	GH27	0.003	234	335	39	124	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIB59833.1	5.20e-168	1	532	6	532
BDA09953.1	4.79e-166	1	532	6	532
SNU96820.1	9.92e-165	1	532	6	529
QCU01578.1	4.65e-148	1	530	26	544
QGQ95278.1	2.37e-147	31	525	36	519

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001837_01209.