CAZyme Information: MGYG000001837_01369

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA737
• CAZyme ID: MGYG000001837_01369
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
422		48461.61	4.8796

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001837	1602907	MAG	Denmark	Europe

• Gene Location: Start: 3608; End: 4876 Strand: +

Full Sequence      

MNSYKKQLEFLDWEFGVFFHFGIRSFYPGHKDWDGEDMPPEKFNPTQLDCEQWVKTAKEA
GATYAILTTKHHDGFALWPSKYSNYSVANTPWKNGKGDVVREFVDACRKHGLKVGLYYSP
AQWGKYSIPFSDEEYDDYFINQIGELLTSYGKIDYLWFDGCGSENHVYDHARIVNAIGEM
QPDILTFCDPEWTPGVRWVGNEDGYASLYNPLVVSSTDFSELAIEVQQLSQAAFLPSECD
CKLRNTWFYDLNEDTIKSVDELFGMYEMSVGHGSNFLINIGPDNRGLLPDADVKRILELG
RRIKENYTLPLPYGDFTKDGDVYTMTHCDVGTPDWKKPSEAHLSNCIMIKEDLTKGQSVE
SFSVYGYLPEYRDKKILLFEGKTIGHKVLCKFSPLRCSKYELVINSYSGDYTIKDIKAFY
VK

Enzyme Prediction     

EC	3.2.1.111

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	3	306	2.8e-81	0.8728323699421965

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	1.67e-60	7	364	15	381	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	2.55e-50	10	306	22	331	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	6.20e-46	3	306	16	333	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam14871	GHL6	1.29e-06	49	127	1	75	Hypothetical glycosyl hydrolase 6. GHL6 is a family of hypothetical glycoside hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS95058.1	8.04e-147	6	420	10	415
BBH22425.1	2.89e-136	6	421	12	415
QHW31138.1	8.42e-133	6	410	22	417
QHT59657.1	1.14e-129	6	420	22	427
ASN07285.1	2.27e-125	6	421	8	401

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3EYP_A	3.52e-76	6	404	13	439	Crystalstructure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],3EYP_B Crystal structure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],4OUE_A Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OUE_B Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_A Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_B Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482]
4ZRX_A	3.25e-74	6	422	35	461	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
3UES_A	1.03e-64	6	405	22	462	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3MO4_A	1.15e-63	6	405	24	464	Thecrystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3MO4_B The crystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3UET_A	1.17e-62	6	405	22	462	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UET_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	2.12e-56	11	410	43	468	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	4.03e-53	7	410	44	467	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
P10901	1.64e-16	12	325	39	389	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1
Q99LJ1	9.09e-16	14	306	43	351	Tissue alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca1 PE=1 SV=1
Q60HF8	1.73e-15	14	306	59	367	Tissue alpha-L-fucosidase OS=Macaca fascicularis OX=9541 GN=FUCA1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001837_01369.