CAZyme Information: MGYG000001837_01378

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA737
• CAZyme ID: MGYG000001837_01378
• CAZy Family: GH5
• CAZyme Description: Endoglucanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
439		48819.36	4.9575

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001837	1602907	MAG	Denmark	Europe

• Gene Location: Start: 4544; End: 5863 Strand: +

Full Sequence      

MKKRMLAAILSGIMVITGISACSGNAATSSENSSASTTTTTTKAETTAATTTTTMTATQN
PEPAPAETKGDSVQFSQNLMPGWNLGNQLESNSDGTPSETAWGNPVITENLIKQVKAQGF
KSIRIPVSYLSKIGEGPDYTIDSKWLDRVQEVVDMCIDNGLYAIINVHGDGYYSIKGGWL
LCGEPASEQETIKAKYEKVWEQIANRFKNYDDHLVFESMNEVFDGSYGNPKPEYYNNINA
YNQIFVDTVRKAGGNNNSRYLLIPGWNTDINFTTGDCDTYTMEAKLVIPNDSRIMVSVHY
YTPWEFCVDEGKDTFYKWGDSVKKFVKPRQSETLVNRQFDKLYNAFIKNGYGVVIGEYGS
NDRTSKDKSNTIYRAYFAEYVNYAAHQRNIVTVYWDNGYNGNHGFGLFDRTECTVTQPEI
INGIINGAKATTAPAAPTE

Enzyme Prediction     

No EC number prediction in MGYG000001837_01378.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	98	398	2e-97	0.9927536231884058

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.80e-65	95	401	12	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	3.12e-26	69	400	41	362	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL35306.1	5.30e-194	80	439	1	355
AIQ53446.1	5.46e-142	72	427	41	399
QAA35398.1	1.30e-141	72	427	44	402
ANY70776.1	1.81e-141	72	427	22	383
ADL50682.1	6.94e-141	71	427	42	401

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JEP_A	8.64e-141	71	427	34	393	Nativefamily 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEP_B Native family 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEQ_A Family 5 xyloglucanase from Paenibacillus pabuli in complex with ligand [Paenibacillus pabuli]
6PZ7_A	1.56e-72	72	426	9	335	GH5-4broad specificity endoglucanase from Clostridium acetobutylicum [Clostridium acetobutylicum ATCC 824]
4IM4_A	1.61e-72	72	428	7	335	ChainA, Endoglucanase E [Acetivibrio thermocellus],4IM4_B Chain B, Endoglucanase E [Acetivibrio thermocellus],4IM4_C Chain C, Endoglucanase E [Acetivibrio thermocellus],4IM4_D Chain D, Endoglucanase E [Acetivibrio thermocellus],4IM4_E Chain E, Endoglucanase E [Acetivibrio thermocellus],4IM4_F Chain F, Endoglucanase E [Acetivibrio thermocellus]
6MQ4_A	2.65e-72	72	428	12	349	ChainA, cellulase [Acetivibrio cellulolyticus]
4YHE_A	2.07e-71	71	410	6	348	NativeBacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a],4YHE_B Native Bacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O08342	8.97e-134	72	427	40	398	Endoglucanase A OS=Paenibacillus barcinonensis OX=198119 GN=celA PE=1 SV=1
P28621	4.13e-71	72	431	42	377	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
P10477	9.53e-68	72	428	57	385	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
P28623	2.35e-67	74	427	45	371	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
P17901	7.56e-60	71	428	46	400	Endoglucanase A OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000002	1.000073	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001837_01378.