CAZyme Information: MGYG000001838_00573

Basic Information

• Species: Zag1 sp000438175
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag1; Zag1 sp000438175
• CAZyme ID: MGYG000001838_00573
• CAZy Family: GT2
• CAZyme Description: Polyprenol monophosphomannose synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
227		25424.59	9.498

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001838	2186237	MAG	Denmark	Europe

• Gene Location: Start: 125006; End: 125689 Strand: +

Full Sequence      

MLTIIIPVYNEGENIKTAVENIEREVKYPYVINVIYDFDEDSTIEPAKKLKVNLVKNKYG
RGVLNAIKTGLEDVQTEFAIVTMADLSDPPQVMNDMINSAVKNNADIVCASRYMSGGGQL
GGPLIKKLMSKFAGLSLHYLAGLPVHDVTNSFKLYRKSFLNEVKIESTGGFELGLELVVK
AFKSGKKITEVPTVWRDRTAGKSNFKLIEWLPKYLKWYFKAFGGKNC

Enzyme Prediction     

No EC number prediction in MGYG000001838_00573.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	3	163	2.1e-19	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06442	DPM1_like	2.67e-45	4	216	1	219	DPM1_like represents putative enzymes similar to eukaryotic DPM1. Proteins similar to eukaryotic DPM1, including enzymes from bacteria and archaea; DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. This protein family belongs to Glycosyltransferase 2 superfamily.
cd04179	DPM_DPG-synthase_like	4.64e-39	4	181	1	185	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
PLN02726	PLN02726	2.63e-31	3	203	12	222	dolichyl-phosphate beta-D-mannosyltransferase
cd04188	DPG_synthase	1.45e-19	4	197	1	206	DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate.
pfam00535	Glycos_transf_2	3.49e-17	3	160	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWB10366.1	1.31e-85	2	221	7	230
ANN63732.1	5.29e-85	1	226	1	232
QTM06000.1	5.29e-85	1	226	1	232
ACN84161.1	5.29e-85	1	226	1	232
QTM11231.1	5.29e-85	1	226	1	232

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EKE_A	2.56e-07	2	164	28	193	Structureof the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKE_B Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKE_C Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKE_D Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa]
5EKP_A	2.56e-07	2	164	28	193	Structureof the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKP_B Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKP_C Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKP_D Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q54LP3	3.19e-24	3	204	21	233	Dolichol-phosphate mannosyltransferase subunit 1 OS=Dictyostelium discoideum OX=44689 GN=dpm1 PE=3 SV=1
Q9LM93	2.03e-23	3	211	16	236	Dolichol-phosphate mannosyltransferase subunit 1 OS=Arabidopsis thaliana OX=3702 GN=DPMS1 PE=1 SV=1
O14466	1.29e-21	3	219	5	231	Dolichol-phosphate mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dpm1 PE=2 SV=1
Q9VIU7	4.08e-19	3	203	9	220	Dolichol-phosphate mannosyltransferase subunit 1 OS=Drosophila melanogaster OX=7227 GN=Dpm1 PE=3 SV=1
O70152	2.10e-18	3	203	28	239	Dolichol-phosphate mannosyltransferase subunit 1 OS=Mus musculus OX=10090 GN=Dpm1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001838_00573.