CAZyme Information: MGYG000001838_00997

Basic Information

• Species: Zag1 sp000438175
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag1; Zag1 sp000438175
• CAZyme ID: MGYG000001838_00997
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide core heptosyltransferase RfaQ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325	MGYG000001838_9|CGC1	36361.61	9.1667

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001838	2186237	MAG	Denmark	Europe

• Gene Location: Start: 67294; End: 68271 Strand: -

Full Sequence      

MNILAINFGGIGDEIFFLPSLISLKKEYPDAKITLALEPRSKSVKDLTDVIDNLFLIDIK
GKNKYTELLKLVYLARRGNFDIVVSSGGNKLISILLTLTGIKKRYGYDTGKLSRLLLTKA
VPLNKNQYACAMYHDLVTPITNHKTYLPEINVEQQQKIPNSVLIHPGVSKMSVQKGMIKT
ISAEIWAETVDLLIEKGKHVILAGGPDDKEVIETIRKNTKNKNFEDYYGKTKNLKDLAIL
IGKAEKFICSDSAPLHVGVAMQTKTYVIFGPTDDNKLIPKSDNVIAIKAQDTCPIKPCLW
EHRQTTCESLECLKITPQYITDLII

Enzyme Prediction     

No EC number prediction in MGYG000001838_00997.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	72	305	9.1e-33	0.9288888888888889

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	6.28e-49	1	287	2	295	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	5.94e-46	2	320	1	271	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK10422	PRK10422	4.55e-21	3	291	8	310	lipopolysaccharide core biosynthesis protein; Provisional
pfam01075	Glyco_transf_9	1.13e-20	76	299	9	237	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
TIGR02195	heptsyl_trn_II	6.88e-15	2	320	1	325	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38411.1	3.62e-184	1	325	1	327
ARV62225.1	1.46e-54	1	289	1	299
BAU12214.1	1.70e-53	1	289	1	301
AFY67702.1	2.26e-53	1	289	1	299
BAI93916.1	5.06e-52	1	289	1	300

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25742	1.24e-14	12	285	5	292	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
Q9R9D5	4.05e-14	12	291	5	298	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001838_00997.