CAZyme Information: MGYG000001838_02241

Basic Information

• Species: Zag1 sp000438175
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag1; Zag1 sp000438175
• CAZyme ID: MGYG000001838_02241
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373		42352.63	9.4118

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001838	2186237	MAG	Denmark	Europe

• Gene Location: Start: 3802; End: 4923 Strand: -

Full Sequence      

MKKLFIVTGEYSGDIHASHVVKALRSINPDIEIEGIGGENLKNAGVKLFSDQRKMGAVGL
SPKIVLDHLTLGKRVVDYLTKEYKPDLVLLIDYGVFNLNISKFLKRAGIKVFYYIPPQVW
ASRKWRINTIKKNIDEVLCIFPFEKEMYESYGIKTHYCGHPLVSQLPDRAARDEFFEKHG
LDKNKKLVSIFPGSRVFELKYLMNVFIKTAENLQKKHPDLQFCVSHAPNLSDNVYNKFLK
NSPFKVIKGENQALLSVSDALMLASGTVALEACLYQTPMIIAYRGPWLFYLIYLIVRCIK
RVSLPNIIADKYIIPEILQGDVNVQKISYEIEKLLFDNEYRAKNIAELGEVKALLSDKIS
SKEAAGVIAEVLS

Enzyme Prediction     

No EC number prediction in MGYG000001838_02241.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	5	354	9.1e-106	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	5.34e-121	1	372	1	375	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.60e-104	1	373	1	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.23e-76	4	370	1	372	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	3.89e-69	6	369	10	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.26e-45	1	371	1	347	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39331.1	3.69e-242	1	372	1	372
VEH12442.1	2.81e-77	2	358	5	365
AEG01383.1	9.64e-77	9	372	15	381
QPK65076.1	4.42e-76	9	372	15	381
QMU61387.1	1.21e-75	4	373	13	385

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	3.30e-47	6	335	11	345	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	4.62e-47	6	335	11	345	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q74AT9	9.79e-72	3	372	8	380	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q1D393	1.49e-70	3	372	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q39T49	6.04e-70	2	372	7	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
B8JE78	1.65e-69	3	357	10	367	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1
B4UHR6	4.61e-69	3	357	10	367	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001838_02241.