CAZyme Information: MGYG000001839_01197

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173
• CAZyme ID: MGYG000001839_01197
• CAZy Family: CBM35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
668	MGYG000001839_25|CGC1	74413.35	5.9725

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001839	2457764	MAG	Denmark	Europe

• Gene Location: Start: 20110; End: 22116 Strand: -

Full Sequence      

MQKLLLSCLILTTPLSVLASNKTYTHDGRQLTVDNSTGAVTIVAGSDTIIKANIPAWGLD
DNVRRPEALQNVKTSSRRISDVHGDALRVTVTGTAGREKATVDYDIYPDFILIRLSVEGD
AAQKDGFALNFLAPVSTRQPYHFTDRSGNYAVSIPYDNDAWVRYTNTPFGDAIPESYEVA
ALFNADTRKGLVIGSVEHDIWKTGIKTATDADAAIVSIEAFGGASSELTRDKRPHGHVAG
KTVKSPRIILISTDDWRDGLELFADQCAAFAPSVPSKGPRPFGWNSWGKLQTKITYDKAV
EVSDFIHDNITNRGFHDADGSVVIDLDAFWDFGFKPHQHREFVQHCHANGQKAGIYWCPF
TDWGGNPDGVLGEDPQYKMKDLYIYVNGEPVKFDGAPALDPTHPGTKARIKRQLEQFIDW
GYEYVKIDFMAHGAYEGDSHYDPSVTTGTQAFNQGMAYIDSINGNRMWINLSIAPLFPAN
YAHSRRISCDAWAGVKDTEYVLNALTYGWWLDHLYHYNDADHVVYEGATDGENRMRITSS
ALTGVYFLGDDMSKDGLESTKERIIRNTGNREINAMARNCKSFRPVEHAKGTSAADMFTN
SDDKYIYVAIFNFTDRPVEKTLPLRRLGLSESINYPAMELWSHDTLNITGAINVAIPARD
VKVFRIEK

Enzyme Prediction     

No EC number prediction in MGYG000001839_01197.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	2.17e-16	279	564	1	294	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd14792	GH27	3.83e-13	281	521	2	214	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam17801	Melibiase_C	2.34e-08	606	666	16	74	Alpha galactosidase C-terminal beta sandwich domain. This domain is found at the C-terminus of alpha galactosidase enzymes.
COG3345	GalA	4.30e-04	272	437	284	459	Alpha-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR69930.1	2.35e-180	30	668	40	675
AII65845.1	2.35e-180	30	668	40	675
QJR74262.1	2.35e-180	30	668	40	675
AND18605.1	2.35e-180	30	668	40	675
QJR65668.1	2.35e-180	30	668	40	675

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000301	0.998920	0.000253	0.000170	0.000167	0.000153

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001839_01197.