CAZyme Information: MGYG000001839_01208

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173
• CAZyme ID: MGYG000001839_01208
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000001839_25|CGC2	40508.92	9.1135

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001839	2457764	MAG	Denmark	Europe

• Gene Location: Start: 33116; End: 34219 Strand: +

Full Sequence      

MHYFISAGEASGDIHAAELIKQLRVADSAARFTFLGGDLMSAAAGIAPLIHYRDMAFMGF
CEVIRHLDKVLHNLSTAKKAIASQRPDALILVDYPSFNLKLAKEAVKLDIPVFYYISPKV
WAWKEGRVRKIKRYVKRMLSILPFEVAYYRDKHGYDIDYVGNPTIKEVDERLASLGTEQS
FRSKHGLGSDRPILALVPGSRVGEIRNNLPVMAEVARRHPDMLPVVAGAPAIERDIYRRY
CDFDIVDNDTFALMAHARGALVTSGTATLEAALTGVPQVVCYRANGSRISYNIFKHILKI
PFVSLPNLIAGKAIVAEQLVHLCNPDLVDAELVKVLPQGTGHDTQQQGYKELRKILTTAD
AAANAAG

Enzyme Prediction     

No EC number prediction in MGYG000001839_01208.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	356	6.3e-109	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	9.04e-109	1	358	2	361	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	8.51e-100	4	358	5	364	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	5.48e-80	4	355	2	362	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.31e-67	5	353	10	366	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.64e-58	1	309	2	286	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR08529.1	7.85e-150	1	367	1	368
ASB37800.1	7.85e-150	1	367	1	368
ANU64105.1	7.85e-150	1	367	1	368
QCD36425.1	1.08e-148	1	362	1	363
QCP71596.1	3.49e-137	1	364	1	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	2.50e-42	7	363	13	373	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	3.49e-42	7	363	13	373	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	3.65e-76	5	366	9	371	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
C1F718	1.61e-65	4	363	8	378	Lipid-A-disaccharide synthase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) OX=240015 GN=lpxB PE=3 SV=1
Q2IL69	4.03e-65	5	356	13	365	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1
B8JE78	8.77e-64	5	356	13	365	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1
B4UHR6	2.45e-63	5	356	13	365	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001839_01208.