CAZyme Information: MGYG000001840_00201

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; UMGS2016
• CAZyme ID: MGYG000001840_00201
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
615		72267.63	8.9935

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001840	1212195	MAG	Denmark	Europe

• Gene Location: Start: 19008; End: 20855 Strand: +

Full Sequence      

MRRKKKKTVEKFTYEKTKKREKFTKVDWVCLSIIVIIFAIFAFSHLGTTKMANTYWKPDM
SGDSVILDIGDAEIDAIYYLVGVGNDPYGNVADLKDVNFEIEASADQINWKPVSLINDIS
MYSWTEIPVSIIGNRYIRIRGYHTAVVMNEIGFKIAGKQKLAQVKYVDGTSYSYTGKELI
DEQDKISLNPSYYDSTYFDEIYHARTAYEQLKGYPIYENTHPVLGKEIISIGIAIFGMNP
FGWRVAGVVFGILMLPILYEFLKQIFKKPIICFIGTFLFAFDFMHFTQSRIATIDTYAVI
FTILIYYFMYRYYRTSFYDTDLKKTYKPLLWCGIFVGIGFASKWNVAYGFIGIAVLFFMN
IYRRYKEYIHAKEMVTVKHSTDEMDQHVYESFIPNLKKTILRCILYFVIIPLLIYYLSFI
FIYDITNIVQYTKDVIDYNVHMFQYHNDLVASHPYQSAWYEWPLIIRPIWYAWNESTVQM
GAVSSISAFGNPFVWWGGLIAMIITLIFAIKKKDKIAWFIVIGYLSVYLPWVYITRITFI
YHYYPAVIFLVLALAYIANKIVEKWKWGKQCILIYASLSFICFIYFYPILSGSWTTREYL
KQLQWFPTWTFMTGD

Enzyme Prediction     

No EC number prediction in MGYG000001840_00201.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	192	420	4.8e-52	0.9147982062780269

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16192	PMT_4TMC	2.12e-34	433	607	1	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG1928	PMT1	3.03e-22	433	611	499	695	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam13231	PMT_2	3.98e-12	221	364	2	136	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	6.46e-12	191	365	16	204	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4346	COG4346	7.86e-09	208	365	122	266	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF42044.1	2.27e-141	22	612	345	921
AIQ72362.1	1.28e-137	22	611	2	592
AIQ66842.1	1.56e-135	22	611	442	1031
QGQ95357.1	4.02e-134	22	611	688	1279
CQR52353.1	5.23e-134	22	611	686	1275

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	8.96e-10	442	611	544	729	Structureof S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	8.44e-07	528	609	663	751	Structureof S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L8F4Z2	2.63e-21	198	609	67	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
P9WN04	2.58e-18	198	609	73	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	2.58e-18	198	609	73	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
Q8NRZ6	1.48e-12	221	609	99	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1
P33775	4.91e-09	442	611	544	729	Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999925	0.000095	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
26	48
240	262
269	286
291	313
325	342
346	363
403	425
493	510
517	534
539	558
571	590