CAZyme Information: MGYG000001844_00372

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; Borkfalkia
• CAZyme ID: MGYG000001844_00372
• CAZy Family: CE15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357		40705.04	6.0946

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001844	1175163	MAG	Denmark	Europe

• Gene Location: Start: 1296; End: 2369 Strand: +

Full Sequence      

MSPKECGRERETVAKAEKLPGLFVTDKTVEAWEGRRKEVGAILSGEEYGAVPPYVNFSTE
IVKKREEFAGKSVMEWLRLDFEKDGICFSFPARLIYPLCSQKIPFFVFANFSSDVPDRYF
PAEEIIDHGFGVISFNYEDVSVDRDTFGEGAEKLFLKGERTQTDFGKISIWAWAMSRLLD
CLLQRGGADEERIGAIGHSRLGKTALWAGANDRRFRYVFSNNSGCSGAALSRNKEGETVE
FITKTFPHWFCKNYGNYAERESEMPFDQHFLLAMIAPETVVVGAAEKDVWADSKNQYLAC
KAAEEVYRVYGKGGGFSDEIPKTGKEYGRSGIFFRERKGTHYLSREDWLYYIRLMQR

Enzyme Prediction     

No EC number prediction in MGYG000001844_00372.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE15	27	356	9e-69	0.9256505576208178

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1506	DAP2	3.91e-05	129	226	423	508	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE95892.1	1.00e-93	27	357	24	359
QIA08469.1	2.52e-69	32	357	53	418
ALL53565.1	1.47e-68	11	348	5	348
AEV29352.1	2.16e-67	19	357	11	367
QOV20253.1	3.24e-67	21	348	22	348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GRW_A	3.34e-58	121	352	156	390	GlucuronoylEsterase from Opitutus terrae (Au derivative) [Opitutus terrae PB90-1],6GS0_A Native Glucuronoyl Esterase from Opitutus terrae [Opitutus terrae PB90-1]
6SYU_A	5.16e-58	121	352	174	408	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with xylobiose [Opitutus terrae],6T0I_A The wild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with the aldotetrauronic acid XUX [Opitutus terrae]
6SYR_A	7.53e-58	121	352	185	419	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1]
6SYV_A	1.43e-57	121	352	174	408	Theglucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1],6SZO_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-galacturonate [Opitutus terrae PB90-1],6T0E_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1],6T0E_B The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1]
7B7H_A	3.96e-57	121	352	174	408	ChainA, Putative acetyl xylan esterase [Opitutus terrae PB90-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0K2VM55	2.58e-52	123	352	189	420	Carbohydrate esterase MZ0003 OS=Unknown prokaryotic organism OX=2725 GN=MZ0003 PE=1 SV=1
P0CU53	1.32e-20	17	311	43	338	4-O-methyl-glucuronoyl methylesterase 1 OS=Wolfiporia cocos (strain MD-104) OX=742152 GN=WOLCODRAFT_23632 PE=1 SV=1
D8QLP9	2.91e-20	28	311	50	324	4-O-methyl-glucuronoyl methylesterase OS=Schizophyllum commune (strain H4-8 / FGSC 9210) OX=578458 GN=SCHCODRAFT_238770 PE=1 SV=1
B2ABS0	6.97e-20	21	311	132	412	4-O-methyl-glucuronoyl methylesterase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=ge1 PE=1 SV=1
A0A0A7EQR3	1.10e-17	6	311	97	405	4-O-methyl-glucuronoyl methylesterase OS=Cerrena unicolor OX=90312 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001844_00372.