CAZyme Information: MGYG000001846_00466

Basic Information

• Species: CAG-1435 sp900769665
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-314; CAG-1435; CAG-1435 sp900769665
• CAZyme ID: MGYG000001846_00466
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
433		49918.81	4.8835

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001846	2118081	MAG	Denmark	Europe

• Gene Location: Start: 6812; End: 8113 Strand: -

Full Sequence      

MVKRYLCLWVAILLIFSMLAVAACKTIAPNDPVQPIDPDSTVLSKLTATNGKVTNDDGKE
VLLRGTNVGGLFVTEHWMTGFVYGGSPSNDYRSLTQTFIKRFGEEQTKALWAEYRSDWWQ
EVDLKICADMGFNVLRLPFTYMNVDFAAVTDYENAGKQYDFSDLDNFVNTAAKYGMYTIL
DLHGAYGSQNGQDHSGQIIDNVSDVDFYSNEQMMSLTIKLWGALAEHFRGNTNVAGYDIL
NEPGEKAGVTSERHWNFYNRVYNAIRAKGDEHIVIFESCWDAENLPRVEQYGWTNCMYSF
HHYAGDELSYTDYCNRWNYKLSSVASKNFGVPLFMGEFTNYKFYDNWRYTLNLLNKSDWH
WTTWTYKVWNNSAWGVVNVRGSNNDKVRADTDSYEDIIKKFGYLRTEFCQKYTFSNGITL
ENLLIEFAKTNED

Enzyme Prediction     

No EC number prediction in MGYG000001846_00466.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	97	367	6.4e-82	0.9961977186311787

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.56e-21	128	372	34	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.30e-20	61	276	16	225	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZS15177.1	6.52e-88	45	408	50	399
VEI36204.1	1.27e-87	53	407	53	393
AIC93076.1	1.59e-74	49	407	33	380
QQV05865.1	1.77e-74	44	401	842	1191
QMW75669.1	1.77e-74	44	401	842	1191

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	3.82e-18	62	309	8	258	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]
3O6A_A	3.96e-18	62	309	13	263	F144Y/F258YDouble Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1CZ1_A	6.91e-18	62	309	8	258	Exo-b-(1,3)-glucanaseFrom Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
4M80_A	7.17e-18	62	309	13	263	Thestructure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans at 1.85A resolution [Candida albicans SC5314],4M81_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with 1-fluoro-alpha-D-glucopyranoside (donor) and p-nitrophenyl beta-D-glucopyranoside (acceptor) at 1.86A resolution [Candida albicans SC5314],4M82_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with p-nitrophenyl-gentiobioside (product) at 1.6A resolution [Candida albicans SC5314]
2PF0_A	7.22e-18	62	309	14	264	ChainA, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
W8QRE4	3.57e-28	43	304	1	249	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
Q4WK60	3.47e-20	62	266	41	235	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
B0XN12	3.47e-20	62	266	41	235	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
A1D4Q5	1.56e-19	62	266	41	235	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1
Q12626	2.41e-19	65	309	51	293	Glucan 1,3-beta-glucosidase OS=Pichia angusta OX=870730 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000002	1.000047	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	22