CAZyme Information: MGYG000001846_01439

Basic Information

• Species: CAG-1435 sp900769665
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-314; CAG-1435; CAG-1435 sp900769665
• CAZyme ID: MGYG000001846_01439
• CAZy Family: GH13
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
610		70816.63	5.5754

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001846	2118081	MAG	Denmark	Europe

• Gene Location: Start: 7243; End: 9075 Strand: +

Full Sequence      

MSIYTQFYNGESTNAYELLGCHNVGDGLYRFSVWAPNAVSVCVIGDFNNWLVNHDVMSRE
DGIWQITLEAKNGDCYKYAITTAAGNVLYKADPYGTFAELRPRTASVIYDPEEKFVWSDE
DWVAKQTKKDIYKSPVNIYEVHAGSWRRHYDGKLYSYRDLAKYLVPYVKKMGYTHVEFLP
LAEHPFDGSWGYQVTGFYAPTSRYGTPDDLRYLVNAFHNAGIGVILDWVPAHFCKDAQGL
MEFDGTCCYESSDEFKKEHKNWGTRIFDYSRYEVQSFLVSNAVYWLKEFHFDGLRVDAVA
SMLYLDYDRKDGEWRPNKWGGKENLEAIDLLKKLSCHVFEACPYALYIAEESTAFPKVTH
PTYVGGLGFNFKWNMGWMNDVLSYMQTDTLWRGEHHNQLTFSMCYAYSENYILPLSHDEV
VHMKGSLINKMFGDYDTKFAQLKALLGFQYAHPGKKLLFMGGELAQWNEWSEERELDWML
LSYPKHDAHQRFVRDMNKAYKKYKPLYFNDHDWEGFEWRLADAANDNVIAFERYDKKGDA
VLVVVNFGQYDYNNYGFNVTPGTYKLILNSDDAKYGGRGVEVAETLTTDENGYVEVVMPG
SSVQYYYLKK

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	166	466	1.5e-152	0.9966777408637874

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12313	PRK12313	0.0	3	591	12	604	1,4-alpha-glucan branching protein GlgB.
PRK14706	PRK14706	0.0	18	603	26	616	glycogen branching enzyme; Provisional
PRK14705	PRK14705	0.0	10	592	614	1200	glycogen branching enzyme; Provisional
COG0296	GlgB	0.0	6	585	13	598	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK12568	PRK12568	0.0	2	577	110	691	glycogen branching enzyme; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL01646.1	7.88e-239	7	606	20	631
AXB29737.1	1.55e-237	7	606	20	631
CBK98932.1	2.09e-235	7	606	20	631
AXA81819.1	7.96e-235	7	606	20	631
QIA41789.1	1.75e-234	7	606	20	631

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1M7X_A	1.40e-198	10	590	5	590	TheX-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_B The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_C The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_D The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli]
4LPC_A	3.36e-198	16	590	6	585	CrystalStructure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_B Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_C Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_D Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LQ1_A Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_B Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_C Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_D Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],5E6Y_A Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_B Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_C Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_D Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_A Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_B Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_C Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_D Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_A Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_B Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_C Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_D Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A]
5GQW_A	2.64e-197	7	577	137	736	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR0_A	2.64e-197	7	577	137	736	Crystalstructure of branching enzyme D501A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GR5_A	3.74e-197	7	577	137	736	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q31IB6	8.05e-217	7	594	112	704	1,4-alpha-glucan branching enzyme GlgB OS=Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2) OX=317025 GN=glgB PE=3 SV=1
Q8CZE8	1.51e-215	7	579	12	592	1,4-alpha-glucan branching enzyme GlgB OS=Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831) OX=221109 GN=glgB PE=3 SV=1
B8CVY1	5.08e-212	7	599	14	618	1,4-alpha-glucan branching enzyme GlgB OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) OX=373903 GN=glgB PE=3 SV=1
Q47II8	1.22e-210	7	594	10	600	1,4-alpha-glucan branching enzyme GlgB OS=Dechloromonas aromatica (strain RCB) OX=159087 GN=glgB PE=3 SV=1
Q2YB47	1.27e-207	7	577	122	699	1,4-alpha-glucan branching enzyme GlgB OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71) OX=323848 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001846_01439.