CAZyme Information: MGYG000001852_00379

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA11940
• CAZyme ID: MGYG000001852_00379
• CAZy Family: GH16
• CAZyme Description: Beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
258		29119.18	4.2425

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001852	1523904	MAG	Denmark	Europe

• Gene Location: Start: 6196; End: 6972 Strand: -

Full Sequence      

MKKFLCLIVAVVFLSLFAVTGCDIFNSDGNGGNVPGMPDDSAEELPDKFTAEEDIIVNFA
TGETSDFYSSHNYSNGQMFNCTWSRDNTVIKDGIMNMSVTKGTDKFYGAEYRSRTRYSYG
YYSVCMKAAKCSGVVSSFFTYTNNPWDEIDIEFLGNDTTKVQFNYYTSGKGGHEYHYSLG
FDASEDFHEYGFDWQEDSLTWYVDGKAVYRATAEIPVTDTQIMMNVWNCIGHDEWTGPLD
ESSLPATAQYKWVAYKAA

Enzyme Prediction     

No EC number prediction in MGYG000001852_00379.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	58	254	4.6e-74	0.9902912621359223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02175	GH16_lichenase	3.41e-94	59	257	5	212	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
pfam00722	Glyco_hydro_16	1.06e-47	83	238	1	158	Glycosyl hydrolases family 16.
cd00413	Glyco_hydrolase_16	3.86e-42	70	255	14	209	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
COG2273	BglS	2.09e-36	64	255	56	264	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
cd02183	GH16_fungal_CRH1_transglycosylase	2.97e-24	119	251	47	195	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADD61790.1	2.53e-81	1	258	3	256
CCO06214.1	2.21e-79	1	257	1	253
ADU22000.1	2.46e-75	55	258	55	262
ADZ85659.1	1.16e-74	21	257	17	253
EGC02853.1	2.05e-74	1	258	1	263

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3I4I_A	1.31e-69	62	255	25	231	Crystalstructure of a prokaryotic beta-1,3-1,4-glucanase (lichenase) derived from a mouse hindgut metagenome [uncultured murine large bowel bacterium BAC 14],3I4I_B Crystal structure of a prokaryotic beta-1,3-1,4-glucanase (lichenase) derived from a mouse hindgut metagenome [uncultured murine large bowel bacterium BAC 14]
3WVJ_A	3.12e-67	55	255	11	213	ChainA, Beta-glucanase [Acetivibrio thermocellus ATCC 27405],3WVJ_B Chain B, Beta-glucanase [Acetivibrio thermocellus ATCC 27405]
1MAC_A	1.27e-64	73	255	22	209	CrystalStructure And Site-Directed Mutagenesis Of Bacillus Macerans Endo-1,3-1,4-Beta-Glucanase [Paenibacillus macerans],1MAC_B Crystal Structure And Site-Directed Mutagenesis Of Bacillus Macerans Endo-1,3-1,4-Beta-Glucanase [Paenibacillus macerans]
1BYH_A	1.36e-64	73	255	24	211	MOLECULARAND ACTIVE-SITE STRUCTURE OF A BACILLUS (1-3,1-4)-BETA-GLUCANASE [synthetic construct],1GLH_A Cation Binding To A Bacillus (1,3-1,4)-Beta-Glucanase. Geometry, Affinity And Effect On Protein Stability [Paenibacillus macerans],2AYH_A Crystal And Molecular Structure At 1.6 Angstroms Resolution Of The Hybrid Bacillus Endo-1,3-1,4-Beta-D-Glucan 4- Glucanohydrolase H(A16-M) [hybrid]
1U0A_A	1.09e-63	73	255	24	211	ChainA, Beta-glucanase [Paenibacillus macerans],1U0A_B Chain B, Beta-glucanase [Paenibacillus macerans],1U0A_C Chain C, Beta-glucanase [Paenibacillus macerans],1U0A_D Chain D, Beta-glucanase [Paenibacillus macerans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37073	2.32e-65	51	255	31	249	Beta-glucanase OS=Brevibacillus brevis OX=1393 GN=bglBB PE=1 SV=1
A3DBX3	3.75e-65	49	255	25	242	Beta-glucanase OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=licB PE=1 SV=1
P45797	1.96e-64	64	255	39	235	Beta-glucanase OS=Paenibacillus polymyxa OX=1406 GN=gluB PE=3 SV=1
P23904	1.53e-63	73	255	47	234	Beta-glucanase OS=Paenibacillus macerans OX=44252 PE=1 SV=2
Q53317	2.46e-63	55	255	574	786	Xylanase/beta-glucanase OS=Ruminococcus flavefaciens OX=1265 GN=xynD PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000042	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	27