CAZyme Information: MGYG000001853_00900

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; UBA1242; UBA11517
• CAZyme ID: MGYG000001853_00900
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
178		20385.09	4.3257

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001853	1210246	MAG	Denmark	Europe

• Gene Location: Start: 8426; End: 8962 Strand: -

Full Sequence      

MKWFFSIFFCLSFVFLAVFGVNCVYGYIFPIKFQGEIENACEIYDVDQAVVFSLINVESH
FNKNALSSKGAVGLMQVMPSTAQGLAKEIGTDEEYDLQNPDDNIMFGTYYISKLIDKFEI
LETALAAYNAGPTNVTNWLNDEKYSDDGSTLKDIPFEETKNYVERFKTNYNYYSKKIK

Enzyme Prediction     

No EC number prediction in MGYG000001853_00900.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	49	175	1.9e-30	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.28e-63	30	171	1	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.26e-51	29	176	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	5.63e-40	49	171	2	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	1.81e-33	19	175	125	285	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	2.68e-31	44	140	8	104	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAA33953.1	2.47e-40	23	173	23	175
SLK19900.1	1.02e-39	27	173	27	175
ATD56881.1	1.02e-39	27	173	27	175
QBJ75740.1	1.02e-39	27	173	27	175
ATD55446.1	1.02e-39	27	173	27	175

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.67e-18	21	174	406	556	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	1.67e-18	21	174	410	560	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.68e-18	21	174	420	570	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	1.68e-18	21	174	426	576	Lytictransglycosylase in action [Neisseria meningitidis]
6FPN_B	1.68e-18	21	174	416	566	Lytictransglycosylase in action [Neisseria meningitidis MC58]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O64046	6.68e-21	32	171	1421	1542	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	6.68e-21	32	171	1421	1542	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O31608	3.65e-19	34	170	61	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P39434	1.50e-12	29	164	476	616	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC3	2.04e-12	29	164	476	616	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.272660	0.721590	0.004312	0.000459	0.000344	0.000612

TMHMM  Annotations     

start	end
7	29