CAZyme Information: MGYG000001854_00130

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA11940
• CAZyme ID: MGYG000001854_00130
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
510		58363.01	7.956

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001854	1440109	MAG	Denmark	Europe

• Gene Location: Start: 5286; End: 6818 Strand: +

Full Sequence      

MATSKSSGKTATKTTAKTTAAKSAAKKVKPAEKELTIVPAKRKILFVASECTPFIVTGGL
AEVIGSLSKALAATGNYDVRVVIPLYSDIKKEFRDKFKYLGNIYVHLAWRNQYCGIFSYE
KDGVIFYFLDNEFYFKRPGCYGYFDDGERFAFFSRAVLEIMPFLNFYPEVMHCHDWQAAL
AAIYLKTNYCFRQEYQFIRALFTIHNIEYQGQYSLDILSSLFDIYGKYQYLVEYNNSINL
MKGAIECCERFSTVSPRYAQEIKDPYFAHGLDPIVRRNEFKLVGILNGIDDKSYNAELDS
HIFANFTADDMSGKAVCKQELQKLLNLPVKADTPIISMISRLVSHKGLDLVINVLEELLQ
SDVQVVILGTGDSYYEGFFKDLARRYPEKMSAQIMFNNDLARKIYSGSDIFLMPSKSEPC
GLSQMIACRYGTIPVVRETGGLYDSIKPQQNGYTFTNYNAHDMLYVIREAVGDYKNKEVW
SKMMYRAMTTDFSWNNSAKQYEALYNDMLK

Enzyme Prediction     

No EC number prediction in MGYG000001854_00130.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	43	506	1.7e-169	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0297	GlgA	0.0	43	505	2	475	Glycogen synthase [Carbohydrate transport and metabolism].
TIGR02095	glgA	0.0	43	506	2	471	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK00654	glgA	0.0	43	510	2	465	glycogen synthase GlgA.
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	43	505	1	472	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK14099	PRK14099	2.20e-104	43	509	5	480	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFS77673.1	1.43e-174	43	508	2	475
BCI60006.1	1.12e-170	43	508	2	472
QNL45767.1	6.74e-170	39	509	18	496
QAT49200.1	1.94e-166	43	510	2	473
QNO18264.1	2.65e-166	43	510	2	473

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3D1J_A	1.43e-83	43	505	2	473	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	6.93e-83	43	505	2	473	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	5.35e-82	43	505	2	473	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
4HLN_A	3.76e-74	42	505	125	622	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]
6GNE_A	3.62e-72	44	505	12	494	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4J4I4	2.26e-162	43	509	2	475	Glycogen synthase OS=Desulfotomaculum reducens (strain MI-1) OX=349161 GN=glgA PE=3 SV=1
A6TSC8	6.07e-156	43	508	2	474	Glycogen synthase OS=Alkaliphilus metalliredigens (strain QYMF) OX=293826 GN=glgA PE=3 SV=1
Q97GX6	1.70e-153	43	509	2	477	Glycogen synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=glgA PE=3 SV=1
Q72YJ6	1.88e-152	44	510	3	476	Glycogen synthase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) OX=222523 GN=glgA PE=3 SV=1
A4IS20	2.54e-152	43	510	2	476	Glycogen synthase OS=Geobacillus thermodenitrificans (strain NG80-2) OX=420246 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001854_00130.