CAZyme Information: MGYG000001855_01731

Basic Information

• Species: CAG-632 sp000431515
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-632; CAG-632 sp000431515
• CAZyme ID: MGYG000001855_01731
• CAZy Family: GH5
• CAZyme Description: Endoglucanase C307

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
345		39753.98	4.6686

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001855	2470907	MAG	Denmark	Europe

• Gene Location: Start: 130226; End: 131263 Strand: +

Full Sequence      

MRIVEGYQKGINLGGWLSQGSLNKAHLDTFIQESDIEKIASWGADHVRLPLDYENIEYED
GRTKEEGFQYIDNCIAWCRKHHLNLVLDLHKTYGYIFDDPDYSSEFFHSEALQQRFLSIW
EKIITRYAKDSDMMMFELLNEVVPADVVDEWNDLSQRGIRLIRKYAPTAKILYGGVCYNA
VTSIKKLLPPADENIVYNFHCYEPLLFTHQTAQWVEGMPADFHINYPGNFDVYMQISKTI
KGTMNGALAEEGLNLTSLGPDFFEKMFLDGIQAAEHFDVPLYCGEYGVIDQAPPEDTIRW
FHDINSVFKKYGIGRAVWTYKEMNFGIVGPHYDSVREALVDSIFG

Enzyme Prediction     

EC	3.2.1.-	3.2.1.4	3.2.1.73

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	10	325	3.4e-136	0.9968051118210862

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	6.52e-21	1	218	45	277	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	2.66e-20	28	215	22	208	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK82603.1	1.93e-169	1	340	1	340
BCN29487.1	2.43e-128	1	340	1	335
ADU22290.1	2.07e-120	1	340	1	338
EGC02962.1	6.34e-117	1	340	1	338
ADD61786.1	3.49e-111	1	340	1	337

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	7.96e-80	7	341	4	336	ChainA, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	2.25e-79	7	341	4	336	ChainA, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
3AMC_A	9.08e-26	9	345	14	312	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]
3AOF_A	6.31e-25	9	345	14	312	Crystalstructures of Thermotoga maritima Cel5A in complex with Mannotriose substrate [Thermotoga maritima MSB8],3AOF_B Crystal structures of Thermotoga maritima Cel5A in complex with Mannotriose substrate [Thermotoga maritima MSB8]
3AZR_A	6.31e-25	9	345	14	312	DiverseSubstrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellobiose [Thermotoga maritima MSB8],3AZR_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellobiose [Thermotoga maritima MSB8],3AZS_A Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Mannotriose [Thermotoga maritima MSB8],3AZS_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Mannotriose [Thermotoga maritima MSB8],3AZT_A Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_C Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_D Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16169	2.70e-84	5	315	5	288	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3
P0C2S3	4.36e-79	7	341	4	336	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
P23340	6.16e-79	7	341	4	336	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
A3DJ77	6.16e-79	7	341	4	336	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
P25472	3.40e-19	10	318	38	297	Endoglucanase D OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001855_01731.