CAZyme Information: MGYG000001857_00618

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Succinivibrionaceae; Succinivibrio
• CAZyme ID: MGYG000001857_00618
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
655	MGYG000001857_26|CGC1	73087.87	9.0939

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001857	1776473	MAG	Denmark	Europe

• Gene Location: Start: 12934; End: 14901 Strand: -

Full Sequence      

MLILPIIAVLGSIFISSIPKLDVYEQRSLAIYDREANLIAYNLTADGYLRLKTTAAEVDP
LYLKLLLASEDKRFKFHLGVDPLAVIRAFFSNLKAGSIVSGASTIAMQTAKNLKKELRCG
YYNKLRQALAAVYLTCTLGREEILNIYLSTVPMGGNLEGVKAASLAWFGHLPDKLSPAEA
ALLVALPRSPEKLRPDKFSKSARYYRNEVLRLGVAEGVIAEDIASAAAREDLPVRMQKIY
QDALCLKNFFNTPDVYEYHTNLDPKIQEILKQAAHDYLQEKNAFETMAAVVINNKTFEVT
GYIGSANTKISLMDLPHALRSPASALKPFIYAKAFDSGLLHPQTIVYDEQEQFGAWAPNN
YSRKFHGAITASESLANSLNLPVIDILLKLDPQRFFLWINTPKNWVKIAQNTRPHAGIGL
GAVSTTLFDLANFYAALANDGLYENARLLQHERKSATYRLLSESSARATYEILKKVRRPD
FAPASEISYKTGTSYQHADAYAIGSLYDYTAAVWVGRPDNRPMPMRKTGFSAAAPYLFKI
LEAIPQHRTPKKALAENGALSREPPLYLRTFYPNALKNKGLKIEFPQNNSTVKPDFYGNI
YVITKNKQGELIMTVNGEIMPDNYFSPQRDGYYSVCAADESGQHDCASFKVELDH

Enzyme Prediction     

No EC number prediction in MGYG000001857_00618.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	52	211	1e-41	0.8983050847457628

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4953	PbpC	6.64e-151	2	544	4	561	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
TIGR02073	PBP_1c	6.39e-145	19	565	2	568	penicillin-binding protein 1C. This subfamily of the penicillin binding proteins includes the member from E. coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this subfamily are presumed to have the same basic function. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
PRK11240	PRK11240	1.29e-96	45	540	57	558	penicillin-binding protein 1C; Provisional
COG0744	MrcB	1.89e-93	2	544	28	596	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	4.80e-80	66	535	18	519	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUN31587.1	7.64e-118	19	653	20	669
AWM88171.1	3.18e-113	21	652	42	703
APX22074.1	1.48e-110	31	598	34	606
QFU18025.1	1.05e-108	14	652	33	698
AVM79618.1	6.94e-108	19	651	29	675

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FGZ_A	2.22e-30	25	522	131	673	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	2.34e-30	25	522	152	694	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]
2OQO_A	7.16e-28	63	222	33	192	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3FWL_A	8.83e-28	25	522	135	677	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli]
3NB6_A	2.47e-27	63	222	33	192	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P76577	1.91e-78	45	540	59	560	Penicillin-binding protein 1C OS=Escherichia coli (strain K12) OX=83333 GN=pbpC PE=1 SV=1
Q9KUC0	1.46e-39	16	552	145	718	Penicillin-binding protein 1B OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mrcB PE=3 SV=1
O66874	4.15e-37	31	544	47	667	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
P38050	8.17e-33	57	516	74	569	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
P45345	1.82e-32	43	533	161	693	Penicillin-binding protein 1B OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=mrcB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.738930	0.257999	0.001123	0.000268	0.000228	0.001448

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001857_00618.