CAZyme Information: MGYG000001858_00330

Basic Information

• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium_A
• CAZyme ID: MGYG000001858_00330
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	MGYG000001858_2|CGC1	40998.12	7.8478

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001858	1937832	MAG	Denmark	Europe

• Gene Location: Start: 44567; End: 45703 Strand: -

Full Sequence      

MSKILISAGEASGDIHAAAVTAAIKKIDSSAQVFGMGGEALRAAGGEVLFDIKDHGVMGF
VEVIKKLPDLFKLRSDFAKVMDERKPDCMVVVDYPGFNMKLAKLAHDKGIPVVSYIAPSA
WAWNKGRAKNVAKIVDKVACIFPFEYDVYKEAGAPVEFVGHPLLDIVHPSMEKAEATAWA
GKESGRPLVLIMPGSRLMEIEKMLPNLLAGAKLLQEQMPQVQFAMPRAGTIPVEMLQDKI
KASGLTVKITEGHNYDLFSVADLALATSGTVTLEAALCGLPSIIVYRTSALNAFIARRVI
NIPNIGLPNIVAGRQILPELLQENFTPEKLAATAVELLQPESRLRLHDDLAYMKQRLGEP
GAVGRVAQLILKIAEEKR

Enzyme Prediction     

No EC number prediction in MGYG000001858_00330.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	357	5.8e-123	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	6.45e-140	1	378	1	379	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.01e-119	1	376	1	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.58e-93	4	373	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	7.77e-92	2	371	6	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.41e-54	1	330	1	309	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTV78315.1	3.03e-233	1	378	6	383
BBG63223.1	1.83e-184	1	378	1	378
QNP77898.1	1.83e-184	1	378	1	378
ADB48042.1	2.20e-142	1	376	1	376
AEQ21864.1	1.51e-137	3	378	2	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	6.36e-55	4	375	9	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	8.92e-55	4	375	9	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q39T49	7.39e-94	3	378	8	384	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q2LVL8	1.43e-93	4	376	6	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B3E4H8	4.05e-93	3	376	8	382	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q74AT9	1.18e-92	3	373	8	379	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q1D393	5.91e-87	3	373	6	377	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001858_00330.