CAZyme Information: MGYG000001858_00356

Basic Information

• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium_A
• CAZyme ID: MGYG000001858_00356
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide core heptosyltransferase RfaQ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351		38672.06	8.0758

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001858	1937832	MAG	Denmark	Europe

• Gene Location: Start: 73272; End: 74327 Strand: -

Full Sequence      

MAKVVELNGKKILVTFLMHLGDLTLTTPFIHALRKAAPSAHITFLADEKLKDVVLHNPYL
DEVITIDKKGRDNSLLALLACARRLSKMDFDVVINLHPNERCSFICAMTKTKLRCGTTHT
LFKPAWDVFTPLNRKIHAADMYLDVLTQLGVVKLEHNGLEIFPSQEHMAHAEEFWRDHGV
FGSDKLVGFNIGSAVVTKRWAPERFAQVADTLAARGYKPVFFGGTMDEEMVQEAISYMKT
TPVVATGNFTVGGLAAAMRRCSLIITNDSGPMHVAISQKVPIVAMYGPSSPKLYGPYTKD
ATIVSAVPPCPGCADGMKHKCSDMQCMTRLTVQQVVQAAEDMLKKHGDGNE

Enzyme Prediction     

No EC number prediction in MGYG000001858_00356.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	80	323	1.9e-52	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	8.80e-70	11	341	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	5.68e-59	10	345	2	332	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	5.32e-27	79	310	2	233	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
TIGR02195	heptsyl_trn_II	4.56e-24	198	343	189	333	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10422	PRK10422	6.66e-19	10	351	6	351	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTV78222.1	8.98e-231	1	345	1	345
QNP77239.1	6.69e-197	5	345	2	342
BBG62449.1	1.57e-195	5	345	2	342
AEQ22076.1	5.74e-163	5	345	2	342
ADB48007.1	1.01e-161	5	345	2	342

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	1.94e-105	6	343	5	345	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]
1PSW_A	2.95e-12	198	307	195	308	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]
2GT1_A	5.53e-06	11	306	2	299	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	5.53e-06	11	306	2	299	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	5.67e-06	11	306	2	299	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25742	1.43e-19	21	300	5	290	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
P45042	1.24e-14	21	307	12	308	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1
Q57336	1.69e-14	10	305	9	300	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1
P37692	1.12e-12	186	307	182	308	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1
P37421	2.74e-12	177	307	173	308	ADP-heptose--LPS heptosyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001858_00356.