CAZyme Information: MGYG000001858_01279

Basic Information

• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium_A
• CAZyme ID: MGYG000001858_01279
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
210		24769.63	8.5947

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001858	1937832	MAG	Denmark	Europe

• Gene Location: Start: 26935; End: 27567 Strand: +

Full Sequence      

MTAKRKTVGHSRRKQRKTGVRLWLALVLAIILLCLGGWKIWQSDAVQMRFVYMWDYQQDI
ITYSKKNHVDPFLVAAIIKNESGFDNKAVSHVGAVGLMQIMPETGRWIAEQMGLIEYKDE
NLYQARTNIRMGCWYLGELEYEFKHNLALMLIAYNAGRGQTHEWMEKFSWDDNFNDLNAI
PFPDTREYVIRVLQDRDKYYLLYCDKVVQN

Enzyme Prediction     

No EC number prediction in MGYG000001858_01279.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	66	197	5e-27	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	3.19e-76	54	198	2	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	7.07e-51	56	203	6	149	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	6.06e-38	71	194	1	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	1.68e-28	55	193	138	277	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	2.41e-28	60	164	1	102	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTV76946.1	1.25e-107	1	207	1	205
BBG64618.1	6.07e-86	12	207	4	198
QNP77119.1	1.67e-83	21	207	24	209
AEQ23289.1	7.65e-62	12	203	3	193
ADB46849.1	4.21e-59	24	210	13	198

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	5.47e-22	52	203	412	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	5.50e-22	52	203	416	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	5.54e-22	52	203	422	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	5.56e-22	52	203	426	573	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	5.59e-22	52	203	432	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39434	2.23e-15	39	200	467	625	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O64046	3.61e-15	52	198	1418	1543	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	3.61e-15	52	198	1418	1543	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O31608	5.24e-14	66	192	70	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P44888	6.20e-14	76	206	448	578	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999805	0.000108	0.000014	0.000000	0.000000	0.000105

TMHMM  Annotations     

start	end
20	42