CAZyme Information: MGYG000001860_00332

Basic Information

• Species: UMGS172 sp900539855
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS172; UMGS172 sp900539855
• CAZyme ID: MGYG000001860_00332
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
246	MGYG000001860_5|CGC1	28372.42	7.2223

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001860	1972754	MAG	Denmark	Europe

• Gene Location: Start: 11100; End: 11840 Strand: +

Full Sequence      

MSIPKVIHYCWFGGSPLPASVKKCIASWKKKCPGYEIKRWDESNTDLNENLYAKQAYEAG
KWAFVSDYFRLKVVYEHGGVYLDTDVELLKSLDVLTENYDGFFGYECGESLVSTGLGFGA
KKGSRFVEAILKDYDGLAFLKQDGSFDETPCPDRNTKTLRLLGVDTDARDQVIDNVVFLK
EEVLCPINFFTGEKRVTKETLSIHHFDASWCSDVTRRTLRLKRLIGIRCYCFLYAKFLHR
SDRWEW

Enzyme Prediction     

No EC number prediction in MGYG000001860_00332.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	20	97	1.5e-23	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	5.85e-20	3	106	82	188	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	1.32e-15	18	95	1	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	1.93e-12	3	147	46	200	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	8.84e-04	34	85	142	193	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO31225.1	1.46e-80	3	226	2	225
ACD37145.1	1.77e-74	3	223	2	221
QGH87046.1	1.77e-74	3	223	2	221
BCG31404.1	1.77e-74	3	223	2	221
BAQ02322.1	1.77e-74	3	223	2	221

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001860_00332.