CAZyme Information: MGYG000001860_01228

Basic Information

• Species: UMGS172 sp900539855
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS172; UMGS172 sp900539855
• CAZyme ID: MGYG000001860_01228
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
722		79773.74	8.8427

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001860	1972754	MAG	Denmark	Europe

• Gene Location: Start: 27071; End: 29239 Strand: +

Full Sequence      

MDGFKCTVIIPSLNPDEKLMHTVTELEKYGFDDIIIVDDGSDKAYAANFPDVEEHPACTV
IHHRVNRGKGAALKTAFKYIIKYRDDVDGVVTIDADGQHLTKDIVNCVSEMKRTGKVVLG
CRDFSRPDVPPRSRFGNKTTRRVLSLFCGVNVSDTQTGLRAIPARFLREMLAVKGTRYEY
ETNMLIAFKQNGIPFCEVPIDTVYINDNETSHFRPFVDSLRIYKLILSFVFSSMFSMLVE
VILFYLGIHFFFNGAKYEILLATVLARVCSSVVNFLVNRNGVFPKGNSFARSLLRYTILA
VPLVLASSGSIRLLKIILGVKSDFVTTLIKMVVDTLLFFVSFRAQQNWVFAPPKKYSSAE
GNTQMPAKKKKLRPAVIVRRTFGCIGSGLLYIIVSVLVLVAVVANGPSTTLRDALVLSAM
QASATKWVPKLFLSDAQVKEIVANSYVDSKLTIDTDNYNKPQEGEFDDAIDGVKYIPANY
TNFKAYIMLIPDPTRVYVGTSSDNYNSAKEGKRIFAMAKKENALALMNGGEFADNGGVGN
GARPIGLTYSKGKCVWNDGSKRTFIGITNENKLVVSEGMSKATADSLGMRDAVSFQTGNL
LIDNDSEGVHIHYKEGNTGAAQRSAIGQRADGTFIFVVTDGRTASSLGATYNEIIDILVS
YGAVTAGMLDGGSSAMLYYEDYYDKYDIDKSGLDEYQLQGLTNKYKAFTPPRRIPTYFCV
SK

Enzyme Prediction     

No EC number prediction in MGYG000001860_01228.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	7	135	1.9e-16	0.7529411764705882

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04179	DPM_DPG-synthase_like	2.32e-37	8	188	1	185	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
COG4632	EpsL	2.02e-27	411	676	35	292	Exopolysaccharide biosynthesis protein related to N-acetylglucosamine-1-phosphodiester alpha-N-acety... [Carbohydrate transport and metabolism].
pfam09992	NAGPA	9.61e-27	522	677	2	144	Phosphodiester glycosidase. This is a family conserved from bacteria to humans. The structure of a member from Bacteroides has been crystallized and modelled onto the luminal region of the human member of the family, the transmembrane glycoprotein N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase. There is some conservation of potentially functional residues, implying that in the bacterial members this family acts in some way as a phosphodiester glycosidase. The human protein is also present, so the eukaryotic members are likely to be catalyzing the second step in the formation of the mannose 6-phosphate targeting signal on lysosomal enzyme oligosaccharides.
COG0463	WcaA	4.78e-16	7	261	6	247	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd04188	DPG_synthase	1.29e-15	8	201	1	203	DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR71698.1	1.89e-90	1	350	1	359
QJS17823.1	7.35e-87	8	350	9	349
AQR92977.1	6.57e-85	8	360	13	365
AGF54073.1	9.21e-85	8	360	13	365
QHJ69351.1	1.00e-84	8	350	6	345

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58619	5.26e-23	8	231	21	243	Uncharacterized protein MJ1222 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1222 PE=4 SV=1
B3VA58	2.48e-16	8	204	8	220	UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminyltransferase OS=Methanococcus voltae OX=2188 GN=aglK PE=1 SV=1
O31980	2.22e-08	492	705	105	307	SPbeta prophage-derived uncharacterized protein YomE OS=Bacillus subtilis (strain 168) OX=224308 GN=yomE PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
230	252
259	277
292	314
382	404