CAZyme Information: MGYG000001861_00515

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; HGM13634
• CAZyme ID: MGYG000001861_00515
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
415		48104.26	8.1265

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001861	1232164	MAG	Denmark	Europe

• Gene Location: Start: 27; End: 1274 Strand: -

Full Sequence      

MEFLYILQEALVWIITIFWVYQLVISICSLINFKEKPILEEKTNKFMAIIPAHNEEAVVE
NLIMSLQKQDYPRDSYDIYVIADNCTDDTAKIAKKAGAIVYERFDSMHKTKGAALNWFLA
QKIEEDAPYDAFCIFDADNIVDVNFLKNMNKKLCQGETVVQGYRDIKNPTDSWVTAGYAI
FYWTMNRFYHLARYNIGLSPLINGTGFMVRFDQVKPEGWNTKTLTEDIEFSLKQIIRGRK
LGWARDAIVYDEQPVGFKQSWSQRSRWTVGHIQCMGEYTKKLALAVKEHKTVMNFDGLLY
IVGSIPMFIITILLLLVNAGLYLGKGLTGTELLWNYARYIVPTFFLPILTAILIMKIEHK
EVKPMAKGLLCYPLFLGSWLAINFKCLFKRNTKWEKIEHVRNIKINDLEKVEEQA

Enzyme Prediction     

No EC number prediction in MGYG000001861_00515.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	46	270	2.4e-23	0.9826086956521739

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	2.48e-83	49	230	2	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
COG1215	BcsA	6.33e-48	10	357	16	374	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	9.59e-48	49	227	2	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06421	CESA_CelA_like	2.29e-24	45	273	2	232	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
cd06437	CESA_CaSu_A2	7.89e-20	50	270	7	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDZ24461.1	4.62e-109	16	409	19	410
QWT55360.1	3.70e-107	21	408	24	413
BCI60981.1	1.14e-101	6	408	10	413
BBB93061.1	1.50e-100	14	408	15	407
CBZ04376.1	1.67e-97	8	411	12	423

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	2.29e-16	32	398	44	412	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
P74165	1.25e-10	49	278	113	343	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
Q8YMK0	5.06e-10	49	278	111	341	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1
Q3MB01	1.58e-09	49	278	111	341	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1
Q84W06	3.55e-06	50	292	98	348	Probable glucomannan 4-beta-mannosyltransferase 14 OS=Arabidopsis thaliana OX=3702 GN=CSLA14 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
10	32
299	321
336	355