CAZyme Information: MGYG000001861_00697

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; HGM13634
• CAZyme ID: MGYG000001861_00697
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
185		21632.26	9.1513

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001861	1232164	MAG	Denmark	Europe

• Gene Location: Start: 6344; End: 6901 Strand: -

Full Sequence      

MKKIIKLIILLIVIALILGAYKCFNIEEKILRYVYPKKYSEYVYKYSEELGIDPLLTLSI
IKTESNFKENTVSRSGAIGLMQLMDNTAKEQAKKLNIEYQKETLYEPEKNIQIGLTYFKN
LLDQFNENYILAFAAYNAGIGNVKTWILEGKIKSDGSDYENIPFPETNMYVRKVVRNYKI
YKELY

Enzyme Prediction     

No EC number prediction in MGYG000001861_00697.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	53	180	4.9e-29	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	2.29e-65	36	180	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	2.30e-59	35	184	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	5.05e-35	54	179	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	9.65e-34	28	185	128	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	1.42e-31	45	155	3	111	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNX55127.1	7.81e-45	31	185	28	183
ADQ40926.1	2.29e-44	30	185	25	178
AEM73461.1	3.24e-44	30	185	25	178
QSZ27862.1	4.45e-44	31	185	28	183
ADV80073.1	6.30e-44	31	185	27	182

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	9.38e-20	31	185	410	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	9.41e-20	31	185	414	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	9.45e-20	31	185	420	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	9.47e-20	31	185	424	573	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	9.50e-20	31	185	430	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39434	6.23e-18	25	175	471	619	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC4	9.90e-17	25	175	471	619	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	9.90e-17	25	175	471	619	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
O31608	9.92e-17	45	178	66	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	1.15e-16	35	178	1418	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.717432	0.223704	0.056489	0.000566	0.000325	0.001491

TMHMM  Annotations     

start	end
4	26