CAZyme Information: MGYG000001862_01519

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Anaerotignaceae; Anaerotignum
• CAZyme ID: MGYG000001862_01519
• CAZy Family: SLH
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1089		114878.96	4.1088

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001862	2256861	MAG	Denmark	Europe

• Gene Location: Start: 23728; End: 26997 Strand: -

Full Sequence      

MNKKVGKMTISMALAAALAFAPAQAFAAPATDISGHWAEKVITQWQEKGLISGYEDGTFK
PDNSVTRAEFVIMLNKALGFTQKGNVAFSDVSANAWYYDAVAVAVEAGYCAGYEDGTFKP
NATITRAEAAVMIAKAKELSANTEAADKFADASRIPAWAKGSIGAVSAAGLMTGRTDGTF
DAANTITRAEAVSSLNRAMETEENEETKDVVVTEDDTVIEGQTIEGNLIIDKAVGDGEVY
VNNTTVKGDVIVRGGGDDSIYFHNVTVKGKVSAEKENVRLQLKGDTDISVIEVKEACNIE
AKDFTGTVDTISIVNEIDTSNKVTIGVPANRVEINEKASVVVKEDVKKLVVSEDAASSKV
EVAKDATVKTVVADAKVSITGSGQIEKLEANADGITISSSTDVKDTEVANGVDKPSTSTG
SSGGGGGSSSGGSSVSVADKLLTATSSAINYKYEDYTYTSQLTHTKDGKNAIVMGEYAVE
DIMSGAAMNDMARYLGALYRFDNGTTVKSITYGDTEYTWSSNLDPTLKGSNWAKDPNGTE
ADGNTLVSVIVDDFQAGKIQDAIQLTLKGSNGSTITLRYGFTVKEDETAKELMEATKSAI
AYQYDDYEYTSQLTHSVNGKNAVVSGRYDTMETVLSGASMNDMARYLGALYRFDNGATVK
SITYNQETYTWSDNLSPALKGSNWVKNPEAPEAEGNTLVSVIVDEFLAGKIQDAITFTLE
GTDGSTLTLQYGFIVGEVTANSSDTLKAALANPSVETVKVSGNITLDEAVNVDRQVTMEV
NEGAQLNLNDSFTVGEKATLINKGTITNNGTMTTNGSFDTYEGKLAGTGHVIVADGAVLK
INANYNNGSDSMLPTVTKIEVQSGGELQSMTTDGGEKATTFVGTSSDARIQTNGATVTFG
FADSYSGTHPTMEIEGDVTIPAGQTWYTMFDSATEAIGIEMILNGNMTVDGTLKVVSANS
TGSELLLKENAVLTVNGTITTAAKGKVTGTDATSVVTIAEGAVGTDTFAAGSAYNWNGAS
WEKAVVENEILAEAEVMTEESVSEESMTEEFVTEESFAEKESDVTEATVVEAEQVNSEEI
TAVTLTEEA

Enzyme Prediction     

No EC number prediction in MGYG000001862_01519.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM54	200	297	4.2e-21	0.8596491228070176
SLH	88	129	1.8e-19	0.9761904761904762
SLH	32	70	6.5e-18	0.9285714285714286

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033190	inl_like_NEAT_1	2.16e-16	35	199	588	752	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.
pfam00395	SLH	8.05e-12	88	129	1	42	S-layer homology domain.
NF033190	inl_like_NEAT_1	4.58e-10	86	209	580	701	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.
pfam00395	SLH	8.77e-09	31	70	2	42	S-layer homology domain.
NF033190	inl_like_NEAT_1	1.01e-06	31	136	644	751	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMJ40768.1	6.98e-106	7	416	8	417
BAU26536.1	2.06e-61	3	396	5	424
CCP24966.1	4.72e-57	27	412	34	424
AEE90469.1	4.72e-57	27	412	34	424
ABO50867.1	3.15e-56	31	412	32	435

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BT4_A	1.28e-09	36	195	33	192	Crystalstructure of the SLH domain of Sap from Bacillus anthracis in complex with a pyruvylated SCWP unit [Bacillus anthracis]
3PYW_A	1.30e-09	36	195	12	171	Thestructure of the SLH domain from B. anthracis surface array protein at 1.8A [Bacillus anthracis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C6CRV0	2.63e-17	37	197	1291	1457	Endo-1,4-beta-xylanase A OS=Paenibacillus sp. (strain JDR-2) OX=324057 GN=xynA1 PE=1 SV=1
P38537	4.13e-17	33	174	39	178	Surface-layer 125 kDa protein OS=Lysinibacillus sphaericus OX=1421 PE=3 SV=1
Q06852	4.47e-16	46	200	2099	2265	Cell surface glycoprotein 1 OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=olpB PE=3 SV=2
Q06853	2.91e-15	51	199	484	638	Cell surface glycoprotein 2 OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=Cthe_3079 PE=1 SV=1
P38535	6.16e-14	32	204	910	1086	Exoglucanase XynX OS=Acetivibrio thermocellus OX=1515 GN=xynX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000269	0.998959	0.000200	0.000211	0.000193	0.000168

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001862_01519.