CAZyme Information: MGYG000001863_00800

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA1259
• CAZyme ID: MGYG000001863_00800
• CAZy Family: GH151
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
671		76919.55	5.3641

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001863	1230663	MAG	Denmark	Europe

• Gene Location: Start: 4176; End: 6191 Strand: -

Full Sequence      

MSNKWYSKVYRRNLVDMHIEDWNEEFLSKFDVDEYFNNLVKAKIQSPMIYFQSHTGLCNF
PTNVAKTHNAFINDNKIKKLVDKCIDAGMDVVGYYSVIYNTWAEKNHPEWAIRIPDGRTH
IDLGQRYGLCCPNNLEYRAFIREQVKEMASCYKGIKGLFYDMLFWPMPCHCDACKKRWEE
EVGGLMPEKEDWNDERFKLHVKKMQEWMAEFSAYLVTLTNEFYPGVTTEQNCATVLAFSG
KCAQTENVNDNCEFAGGDLYGNLYSHSFCAKYYREVTKNPPFEYMVCRCDKSLNEHTASK
TDNMLKTELMLTSYHHGANLIIDAINPDGTLDGRVYENIGRIFDKIAPFEQFYEGEMVKD
VGLFFDSKVKFNPERGYHACNMFSGVNACQTLIENHIPVSVIANGIMDRIKDYKLIVAGE
LQDFIGNDYEETIYDYVKNGGNLYLSGKSNAKLMKEFFGAEFVGFSKETKTYISPDKSIY
DLFETFNAESPMPINYALPYFKVEDECVVKGKIKLPYTDPANHLQYASIHSNPPGILTDY
PAVMITEYGKGKVVWVAGAIEQEDRVCFKEVFMNIVNKLVGKDNFTINSKLSGTVETTAF
KTDDAFILNFIELVNVEEKLKKEFDINVKSDRVPKSLTILGDNLSADYSYSNGIVKLKGE
VGNYGTIKINY

Enzyme Prediction     

No EC number prediction in MGYG000001863_00800.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH151	31	162	5.8e-23	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14871	GHL6	8.38e-11	31	162	1	135	Hypothetical glycosyl hydrolase 6. GHL6 is a family of hypothetical glycoside hydrolases.
cd14791	GH36	6.27e-05	75	173	65	163	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd03143	A4_beta-galactosidase_middle_domain	0.003	390	452	33	92	A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to beta-galactosidase from Thermus thermophilus. Beta-Galactosidase hydrolyzes the beta-1,4-D-galactosidic linkage of lactose, as well as those of related chromogens, o-nitrophenyl-beta-D-galactopyranoside (ONP-Gal) and 5-bromo-4-chloro-3-indolyl-beta-D-galactoside (X-gal). This A4 beta-galactosidase middle domain lacks the catalytic triad of typical GATase1 domains. The reactive Cys residue found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow in typical GATase1 domains is not conserved in this group.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBH23071.1	1.70e-125	5	653	2	658
QNK60153.1	6.33e-93	1	623	1	650
BBD45930.1	2.60e-87	2	671	5	695
AVM44410.1	8.03e-73	10	592	17	610
BBH24081.1	3.29e-39	296	657	19	382

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001863_00800.