CAZyme Information: MGYG000001865_00069

Basic Information

• Species: UBA1409 sp002491605
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA1409; UBA1409 sp002491605
• CAZyme ID: MGYG000001865_00069
• CAZy Family: GH5
• CAZyme Description: Endoglucanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	MGYG000001865_1|CGC3	42721.3	4.5554

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001865	1856420	MAG	Denmark	Europe

• Gene Location: Start: 83066; End: 84202 Strand: +

Full Sequence      

MKKLFTVLFAAVVLCAALCSCGGSDKKSMHSDPKATPEVLTVEEVITDMKIGWNLGNTLD
APNGETSWGQPETTKAMIDTVCELGFGTIRIPVSWGRHVSGDDHKIDKKWMDRVQEVVDW
ALDNDMYVILNSHHDNEYYYPSKEKSEESVKYINDIWTQIAERFKDYDQHLIFESMNEPR
LSGTPNEWSFNSNVQDCLDAAEVINLCNQEYVDVVRASGGRNTDRFLMVAPYAAAPYSAL
ADEFVLPKDPSDKLLLSVHAYTPFDICMDNDLSKRTFTDQSKAAINDFMDKLSDKFIANG
TRVIIGECGIINKGNPEDRYLWGEYFVSKAKEYGMMCVVWDNAAVELGSENYGILDRRKL
KVFSESEEYFKGLMAGLK

Enzyme Prediction     

EC	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	65	342	2.7e-97	0.9855072463768116

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	5.04e-63	59	342	10	268	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	2.83e-33	48	363	50	381	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIF25951.1	1.11e-104	1	363	1	380
AGM71677.1	5.76e-102	20	361	14	386
ACZ98609.1	1.84e-101	44	358	64	398
QOS40966.1	6.35e-100	1	365	1	375
AIF26244.1	1.84e-99	1	360	9	384

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4X0V_A	3.60e-103	46	361	44	381	Structureof a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_B Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_C Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_D Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_E Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_F Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_G Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_H Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32]
5H4R_A	1.02e-102	46	361	44	381	thecomplex of Glycoside Hydrolase 5 Lichenase from Caldicellulosiruptor sp. F32 E188Q mutant and cellotetraose [Caldicellulosiruptor sp. F32]
6PZ7_A	4.09e-95	37	360	4	322	GH5-4broad specificity endoglucanase from Clostridium acetobutylicum [Clostridium acetobutylicum ATCC 824]
6WQP_A	1.50e-94	32	360	6	341	GH5-4broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQP_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQV_A GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_C GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_D GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis]
1EDG_A	1.35e-93	46	358	26	358	SingleCrystal Structure Determination Of The Catalytic Domain Of Celcca Carried Out At 15 Degree C [Ruminiclostridium cellulolyticum H10]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P17901	1.23e-91	46	358	51	383	Endoglucanase A OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCA PE=1 SV=1
P28623	2.72e-84	7	377	12	372	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
P20847	4.40e-84	2	361	8	381	Endoglucanase 1 OS=Butyrivibrio fibrisolvens OX=831 GN=end1 PE=3 SV=1
P16216	2.33e-83	36	371	63	395	Endoglucanase 1 OS=Ruminococcus albus OX=1264 GN=Eg I PE=1 SV=1
P23661	8.00e-82	1	374	3	393	Endoglucanase B OS=Ruminococcus albus OX=1264 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000002	1.000052	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001865_00069.