CAZyme Information: MGYG000001865_01395

Basic Information

• Species: UBA1409 sp002491605
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA1409; UBA1409 sp002491605
• CAZyme ID: MGYG000001865_01395
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
181		20859.67	4.4073

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001865	1856420	MAG	Denmark	Europe

• Gene Location: Start: 3323; End: 3868 Strand: +

Full Sequence      

MFKKLLAFLLICVLAVGAYLYLFEYVPHNTYKVMYSDEVTKYSEEFGIDEAFVYAVIRTE
SNFNPNAVSDAGAIGLMQIIEDSFDWVSTKLHETDLEYDDMFTPEYSIKYGCYMLSYLYN
KYESYELAAAAYHSGMGEVDGWLSSGEVDKSSFEIADFKGSNTRFYVKKIMKAYKVYSEL
K

Enzyme Prediction     

No EC number prediction in MGYG000001865_01395.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	51	177	1.7e-29	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	6.82e-57	35	176	4	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	3.21e-40	35	180	6	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	8.18e-33	50	175	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	2.12e-29	35	177	139	283	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd16893	LT_MltC_MltE	1.95e-27	39	175	3	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU24393.1	2.69e-41	24	180	63	223
CCO04775.1	2.41e-39	26	180	50	209
QEY33915.1	1.75e-34	23	179	29	186
QNK41497.1	1.54e-33	29	180	37	187
BCI60027.1	6.37e-32	29	180	31	183

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1SLY_A	1.56e-11	31	177	449	597	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
1QSA_A	5.30e-11	31	177	449	597	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
6CF9_A	9.37e-11	35	180	351	499	Crystalstructure of soluble lytic transglycosylase Cj0843 of Campylobacter jejuni at 2.3A resolution in I23 space group [Campylobacter jejuni],6CFC_A Crystal structure of soluble lytic transglycosylase Cj0843 of Campylobacter jejuni in complex with Bulgecin A [Campylobacter jejuni]
6CF8_A	9.37e-11	35	180	351	499	Crystalstructure of Cj0843 lytic transglycosylase of Campylobacter jejuni at 1.87A resolution [Campylobacter jejuni]
7LAM_A	9.46e-11	35	180	371	519	ChainA, Lytic transglycosylase domain-containing protein [Campylobacter jejuni],7LAQ_A Chain A, Lytic transglycosylase domain-containing protein [Campylobacter jejuni]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39434	7.49e-12	31	177	476	624	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O31608	7.83e-11	39	174	64	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P0AGC3	2.93e-10	31	177	476	624	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	2.93e-10	31	177	476	624	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
Q2NRB3	9.32e-09	35	122	191	280	Membrane-bound lytic murein transglycosylase C OS=Sodalis glossinidius (strain morsitans) OX=343509 GN=mltC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.857280	0.134680	0.006270	0.000411	0.000215	0.001155

TMHMM  Annotations     

start	end
5	27