CAZyme Information: MGYG000001865_01591

Basic Information

• Species: UBA1409 sp002491605
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA1409; UBA1409 sp002491605
• CAZyme ID: MGYG000001865_01591
• CAZy Family: GH98
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
755		85393.91	4.6402

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001865	1856420	MAG	Denmark	Europe

• Gene Location: Start: 4391; End: 6658 Strand: -

Full Sequence      

MKNFKKAVCALMAVLMLITCCACGQSPTVERTVSVCEPNGELRRPISTEQPMWIVHIDSW
NNADPEKIIDLIPEDILPYVVFNISLSISWDSDTKTWGLVNDGYECAKSWLRTCAEKNVW
AMIQPASGGQCHFPDYVEPSDMKDTIFEEFFRDYPNFLGFNYCEQFWGFDQEDFPTTYIE
RYKHFTNLLKLTHDYGGYLVVSWCGNQWGQALNPIAMLKQVPEFEQACLDYTENYILCEK
HTQVGYLHDVESQVLGAYLSGYSGQAGLRYDGSGWTGPDGQTNTKFTMATGVAIHLERLM
QQGYTVIDGPELIWTECFRETSAERTEQGYSSRKWEMYDQFQNVMIDIFRKVLDGTIRIP
TREEVISNTKAVIIQDVDKGDDDAKYCSPKTLFNGLYKMDNDGMLRDNRNFFKKSGRYPT
IPTVYALADDTAKGFEIQINSSEYNKRWGKEENKLAELNELFPEEYTGDIYARRSDNTWT
VYNPYKSGQSAEGVIPFKYNTADKVELTLSQYSGGIISEYADSLKIYLNNYDNELLSAFK
LKTDVIKVYGCTEEPTLTYNDRGVSQVKSKVNTSWEGGVFTATIEHNGPIDIEISAKGTE
SGRLAEYKTATLVEPKRPPVYHGPHQYEAENFDSISIQKNLPNGCRSGVDGFKGQGYMIF
GSKEDAAVLDHVSVLEDGKYTLTLRYSSPDASISKLNLYVNGKKVSSPSLGKTSSASDWQ
EYTIEVKLNKGDNTVELKATGELQGALYLDCMIIS

Enzyme Prediction     

EC	3.2.1.8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH98	41	357	9.1e-125	0.9877675840978594
CBM35	648	752	1.1e-21	0.8487394957983193

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08306	Glyco_hydro_98M	4.30e-137	41	357	6	328	Glycosyl hydrolase family 98. This domain is the putative catalytic domain of glycosyl hydrolase family 98 proteins.
cd04083	CBM35_Lmo2446-like	4.73e-27	625	754	1	125	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
pfam08307	Glyco_hydro_98C	6.64e-18	362	597	1	270	Glycosyl hydrolase family 98 C-terminal domain. This putative domain is found at the C-terminus of glycosyl hydrolase family 98 proteins. This domain is not expected to form part of the catalytic activity.
cd04082	CBM35_pectate_lyase-like	3.15e-13	627	754	3	124	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.
cd04086	CBM35_mannanase-like	2.69e-10	627	739	3	106	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL51037.1	3.45e-286	24	755	45	779
BAV13045.1	3.45e-286	24	755	45	779
CBL18082.1	4.16e-263	39	754	54	788
AOZ99817.1	6.60e-263	37	755	31	742
AXY74108.1	1.28e-261	42	750	36	744

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WMH_A	1.94e-17	41	594	28	581	Crystalstructure of the catalytic module of a family 98 glycoside hydrolase from Streptococcus pneumoniae TIGR4 in complex with the H- disaccharide blood group antigen. [Streptococcus pneumoniae TIGR4]
2WMF_A	4.49e-17	41	594	28	581	Crystalstructure of the catalytic module of a family 98 glycoside hydrolase from Streptococcus pneumoniae TIGR4 (Sp4GH98) in its native form. [Streptococcus pneumoniae TIGR4]
2WMG_A	7.84e-17	41	594	28	581	Crystalstructure of the catalytic module of a family 98 glycoside hydrolase from Streptococcus pneumoniae TIGR4 (Sp4GH98) in complex with the LewisY pentasaccharide blood group antigen. [Streptococcus pneumoniae TIGR4]
4D6E_A	1.97e-13	72	531	46	482	Crystalstructure of a family 98 glycoside hydrolase catalytic module (Sp3GH98) in complex with the blood group A-trisaccharide (X01 mutant) [Streptococcus pneumoniae SP3-BS71]
4D6D_A	1.97e-13	72	531	46	482	Crystalstructure of a family 98 glycoside hydrolase catalytic module (Sp3GH98) in complex with the blood group A-trisaccharide (X02 mutant) [Streptococcus pneumoniae SP3-BS71]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6RUF5	8.69e-14	41	597	219	800	Blood-group-substance endo-1,4-beta-galactosidase OS=Clostridium perfringens OX=1502 GN=eabC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000383	0.107889	0.891396	0.000111	0.000137	0.000088

TMHMM  Annotations     

start	end
7	29