CAZyme Information: MGYG000001867_00013

Basic Information

• Species: CAG-873 sp900555715
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp900555715
• CAZyme ID: MGYG000001867_00013
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
745	MGYG000001867_1|CGC1	81341.26	5.5718

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001867	2424881	MAG	Denmark	Europe

• Gene Location: Start: 15375; End: 17612 Strand: +

Full Sequence      

MKKSVALCLLAGFSLGSYASGDVLPVYKDESRPLEERVEDALSRMTTADKIAIIHAQSKF
CSAGVASLGIPELWCTDGPHGIRAEVKWDEWDQAGWTNDSCVAFPALTCLAATWNPDMSA
LYGKSIGEEALFRGKDVLLGPGCNIYRTPLNGRNFEYMGEDPYLASVMVVPYIKGVQKNG
VATCVKHYCLNNNEHYRHNTDVTVDDRTLYEIYLPAYKAAVQEGGAWSVMAAYNLYNGQH
LCHNDRLLNKILKDEWGFDGAVISDWGGVHDTREAIMNGMDLEFGTWTNGLTEGTSNAYD
NYYLARPYLDLIRKGEVGTAELDDKARRVLRLMMRTSMNTSKGTGEMCSPAHYTAARRIA
GEGIVLLKNDRNILPLKAAGKPLRILVVGENGIKWMTVGGGSSSLKAQNEVTPLEGIREA
AKDFATVDYARGYVGDLNNEYNRVVAKSDIAENRSAEELFNEAVAKAKEADYVVYVGGLN
KADHNDAEGCDREQYGLPYGQDELIGALVKANKNTVVVNISGTAVAMPWAKDVPAIIQAW
YIGSEAGNAIADVLFGKVNPSGKLPFSFPVKLEDIGAHTFGEAAYPGIKNGDIWEMDYKE
GILVGYRWLENKKIKPLFAFGHGLSYTTFALGKLTADKSEMTADGNITFSVDVTNTGSVP
GAEVVQLYIADNKASVLRPVKELKGFGKVMLQPGETKTVTFTIGKDALSFFDAGKHEWVA
EPGQFTAHVGTASDKIASTLKFNLK

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	63	283	9.6e-66	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	2.03e-132	104	744	120	764	beta-glucosidase BglX.
pfam01915	Glyco_hydro_3_C	3.08e-70	364	606	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
COG1472	BglX	1.21e-65	66	424	56	390	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	5.24e-62	29	722	44	753	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	1.90e-33	68	332	64	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL02169.1	0.0	1	745	7	744
QUT74223.1	0.0	6	745	3	741
QPH58875.1	0.0	1	745	1	741
QMI79977.1	0.0	1	745	1	741
AFD05220.1	0.0	3	745	7	739

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	3.28e-141	38	736	5	660	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	9.43e-113	34	738	1	657	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
3AC0_A	9.81e-110	38	745	6	837	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.09e-107	38	745	6	837	Crystalstructure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
4I3G_A	7.66e-97	9	744	29	828	CrystalStructure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS8	5.57e-271	25	742	33	743	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
P14002	1.80e-140	38	736	5	660	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	1.12e-117	34	745	1	673	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
P27034	5.79e-115	38	744	2	810	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
E7CY69	6.97e-115	34	740	1	668	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000279	0.999018	0.000177	0.000184	0.000168	0.000148

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001867_00013.