CAZyme Information: MGYG000001867_00044

Basic Information

• Species: CAG-873 sp900555715
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp900555715
• CAZyme ID: MGYG000001867_00044
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1504		169770.73	4.9834

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001867	2424881	MAG	Denmark	Europe

• Gene Location: Start: 544; End: 5058 Strand: -

Full Sequence      

MRRFKSLLTIVIAASSVSLSAATPKASDFVPYKTSELRPPSVPLLINDPFFSIWSNYDSL
NDGPTRHWSEHEKALNGILRVDGTAYRFMGPQRASVLVPIAGMTVDGTEWSGRVSYTPTT
GTAWAQPGFDDSSWSTEQAAWGTKGEYPNVKNSWTGENKDIYVRRTVSVTADDLKKNLAI
QYSHDDVFELYINGKRVVSTGETWRQGEVANLSDTQKSWLHEGENVIAAHCHNTTGGSYV
DFGLYENRLQSTDAMELARQNSCDVMATSTYYNFTCGPVNLDLVFTAPMLIDDPDLISTP
INFISYQVKSADGRKHDVQFYLSASPQFTVNEMTQPTQSSVVTENGVRYLKSGSEEQNYC
GRTGDLITIDWGYLYIPAINGEIAIANPLDAERAFVETGKLPESAKGTVRSTSHVTMPSL
AFANDLGNITEARDYMLIGYDEVYDMEYMHKKYKAYYARDGKTIFQAFDEFNRDYSSLMK
RCRELDKKIYDDALAAGNVKYAEMLAANYRLVMGAHKLFRDDKGHMLYFSKENKSGGFVN
TVDLTYPECPIYLLYNPELQKGMMLSILDYALTPERRGKNCAAHDLGIYPQANGMHYGDS
MPLEESANMIILANAICRLTGDGEWLKPYAKVLRTWAEFCRDNGQNPGNQLCTDDFKGPS
EQNTNLSLKAITAVAAYAELAKYIGDDKADSFAGTAKNMALLWEADARDGDHYRMEFHRP
GTWSQKYNLVWDRMWGYNNFPAEIVDREVNFYLNHQQKYGLPLDSRDMQTKSDWIFWTAS
LAPDTDTFLRFSDRHWDYMNETTSRIPLSDFYLADRGTSCNFSGRSVIGGLWIKVLKDRI
QPKPSQTAWEPKGNHIKTRWTYDVDSECPLPEYPRPLMVRKDWVNLNGLWDYAITDGAAP
SEYEGKILVPYPIESSLSGVMRPLEPGKTLWYKREITIPSSWKGKRVLINFGAVDYDAEV
YVNGTTGRQRVASHTGGHTAFSADITSKLTDGKTTIYVKVVDSTDERNQPVGKQRRYPNG
GGDIFYTSTSGIWQTVWLEPVESTYAESVRITPDVDNSTITFAPEVNDGTGATVTVRLLD
GDNVVASKSASAGEDIVLDVAGAKLWSPDSPFLYNVEVEIQKNGKTVDAFDSYAAMRKIG
YAKNENGYWRLQLNNKDLFQFGPLDQGYWPDGLLTAPTDEALRYDVEKTKEWGFNMIRKH
MKTEPARWYRHCDELGILVWQDMPSTFRSDEGWTTHTWYPEHNCSQDATVEKRYRNEWKE
IIDQLYSYPCIVVWTPFNECWGQFKTADIVAYTQSLDNTRLVNPASGGNHYRLGEGTIVD
QHTYDQPIRVFEGIFDPSRPLVLGEYGGLGRNIVGHRWFERDAQTYNTYASERAITDAFD
RLAGQVRDLAEGYETEAGKISYGAAVYTQTTDVETEVNGLMTYDREIVKFNENRLRSIVG
KVTGVYGTSGVEDVVAETTVAGDTIYYNINGLSSSRPFSGFNIVKESDGSTHKMMYSRVN
LEEE

Enzyme Prediction     

No EC number prediction in MGYG000001867_00044.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	880	1317	1.6e-94	0.48936170212765956

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16335	DUF4965	5.83e-65	496	666	1	174	Domain of unknown function (DUF4965). This family consists of uncharacterized proteins around 840 residues in length and is mainly found in various Bacteroides species. Several proteins in this family are annotated as Glutaminases, but the function of this protein is unknown.
pfam17168	DUF5127	1.93e-60	268	492	1	226	Domain of unknown function (DUF5127).
pfam08760	DUF1793	1.58e-59	673	836	2	169	Domain of unknown function (DUF1793). This presumed domain is found at the C-terminus of a glutaminase protein from fungi. This domain is also found as a single domain protein in Bacteroides thetaiotaomicron.
COG3250	LacZ	4.98e-35	874	1303	6	430	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	1.16e-31	885	1303	14	449	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCA48091.1	8.52e-247	156	841	12	702
AHW60263.1	2.77e-207	835	1445	7	600
QIA07412.1	1.93e-203	835	1445	7	600
BBE17791.1	2.54e-202	849	1442	8	584
SCM57946.1	5.60e-202	849	1445	21	600

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	7.62e-192	845	1438	1	578	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
6ED1_A	1.48e-25	931	1301	80	448	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]
4JKM_A	2.34e-24	884	1279	16	415	CrystalStructure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],4JKM_B Crystal Structure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],6CXS_A Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13],6CXS_B Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13]
5UJ6_A	3.52e-23	929	1347	77	520	CrystalStructure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],5UJ6_B Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],6NZG_A Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis],6NZG_B Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis]
6D50_A	3.56e-23	929	1347	85	528	Bacteroidesuniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii],6D50_B Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2U4L7	4.72e-61	260	836	97	689	Glutaminase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gtaA PE=1 SV=2
D4AMT2	2.11e-31	457	830	318	777	Probable glutaminase ARB_05535/05536 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05535/05536 PE=1 SV=2
T2KPJ7	1.56e-26	931	1281	106	432	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
T2KM09	8.43e-26	931	1307	109	459	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
Q48727	5.99e-17	1030	1426	194	578	Beta-galactosidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=lacZ PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000504	0.998349	0.000556	0.000237	0.000176	0.000148

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001867_00044.