CAZyme Information: MGYG000001867_00056

Basic Information

• Species: CAG-873 sp900555715
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp900555715
• CAZyme ID: MGYG000001867_00056
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
676	MGYG000001867_2|CGC1	76019.81	5.1514

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001867	2424881	MAG	Denmark	Europe

• Gene Location: Start: 29163; End: 31193 Strand: +

Full Sequence      

MTLKTKFTTFLILALTSFAAAASTSVTERIAEGEKIASGIPAQVRKAPLIKLPVGSVQPR
GWLRRCLELQRDGLNGHLGTVSAWLDKNNNQWLSDTGDHGWEEVPYWLRGYSSLAYILGD
KAMIDEAQVWFDAVLANAKEDGFFGPRNYEGNRPELWAQMVMLWALQTYYEYSGDKRVLD
TMTRFFKWEQSLDDSVFIKGLWEEKRGGDNLWSLRWLYNITGDDSLLPLADKLHRNTSDW
TMDNTLPNWHGVNVAQGFREPATYFMFTGDSTLLDATRRDFEIMRKIYGQVPGGMYGADE
NARQGYSDPRQGAETCAVVEQMASDEILMQITGDPFWADHCEDVAFNTFPATMTPDLKAL
RYITSPNMAISDEKLHGPSIDNNLRGMLSMSPFSSRCCQHNHGMGWPYYAEHLVMATADK
GLAAMLYSANETTADVADGKTVRLTTETLYPFEETVTMTVGTDAKVRFPLYLRIPSWCRS
AMVKVNGKKIGTDNSAGKYVRIDRTWKNGDKIEMTLPMEVTSRTWKDNKGSISVNYGPLT
LSLKIDETAESHDSRDRAFVQDDSHWQENVDSSLWPSYVLRPASPWNYALKTDSNGLPAG
FSIVRKAWPADDYPFTPQNVPLEFTATGNRIPSWGYDATGMTDILPAPDAPRDTVDTPLR
LIPMGAARLRISAFPQ

Enzyme Prediction     

No EC number prediction in MGYG000001867_00056.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	168	541	1.6e-38	0.7236580516898609

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	4.44e-100	89	542	50	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.91e-28	100	543	57	502	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADJ45365.1	7.03e-169	42	675	49	660
AFO77076.1	7.03e-169	42	675	49	660
AEK42125.1	7.03e-169	42	675	49	660
AGT84204.1	7.03e-169	42	675	49	660
QMU76753.1	1.11e-167	42	675	53	668

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	1.01e-21	155	588	140	621	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	5.15e-20	155	588	140	621	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	6.51e-18	229	544	307	609	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
6YQH_AAA	3.92e-14	311	542	334	560	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	4.68e-13	311	542	334	560	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000899	0.998294	0.000191	0.000224	0.000185	0.000173

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001867_00056.