CAZyme Information: MGYG000001867_00057

Basic Information

• Species: CAG-873 sp900555715
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp900555715
• CAZyme ID: MGYG000001867_00057
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1003	MGYG000001867_2|CGC1	111811.5	6.3988

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001867	2424881	MAG	Denmark	Europe

• Gene Location: Start: 31209; End: 34220 Strand: +

Full Sequence      

MTLSGKISAWSGHTLILIIALCLNGFICSAQTCLSSSGKGRDVFPLVTPRSAATVYYDPD
DYTVVGKTAGLFAGDILEVTGKTMEVTAGKPAGKNVVIAGTIEKNSYIRRLAEQGKIDTS
PLRGAWERYIIRTVPKPFPGIDKALVVAGSDRRGAAYGLLALSELAGVSPWHWWADVPAT
KHSAIYIDAPGELSPAPSVKYRGIFINDEDWGLKPWAAKTFEPERGNIGPRTYARVCELL
LRLKANYLAPAMHPVSAPFYSIAENKLVADSFAIVMGSSHCEPLLLNTASEWDSRRLGPW
NYDTNKARIDSVLDSRVAESCAYENVYTLALRGLHDGAMNGDDASMQAKVRRLGAALKAQ
RDIVAAHHDTAVENVPQAFTPYKEVLEIYDNGLVLPDDVTIIWPDDNFGYMKRLSGPREQ
KRSGRSGVYYHLSYLGVPHSYLWFSTTPPALMYEELRKAYDTTADRIWLANVGDIKGCEM
QMSLFLDMAYDIERFNTQNVVTYPARWLAGMFGSDLYPGFEDVYLSHISLAFARKPEYMG
WGYWNNCHGIGEKRTDTEFSFDNYSEAYRRLNEYGRISAIADSMLATVAENARPALFELF
CYPVKGAALMNAMTMGGQLYRKYVREGRNGATALKKEVECLHDSLEKITDTYNSLLGGKW
RHMMSLRQNYDGSSSYFMVPLMEDVCEPDDSRRLGISVEGESRVKGTGAFRRLPVFSRFS
KQKYHIDIFSRGKDETEWKAVVSHPWIVLSDSTGDTSDKTRIYVSVDWDKAPEQCTAGGT
IEISGGGSTETILVSAFSPVGISDSDIDGLFMEDNGYVSMPAHDFHRKYENDDIKIDILP
GIGIEDSSLRLGNPTAPLQCYRDSNVPRVEYDFYTFNAGIVDVYTYVLPTFPLHAERDFK
LPENNNSDTKYSVRIDDGSIATPSTSAGEYTQPWYESVLRNCRVNKSTLYVRRPGKHTLQ
IRCGDPGTIIQKIVIDTGGLSRSYLGPQSTKFVMESNKKQHNN

Enzyme Prediction     

No EC number prediction in MGYG000001867_00057.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	43	671	7.2e-214	0.8278335724533716

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	9.96e-160	196	537	2	333	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	3.06e-52	811	987	2	170	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam05124	S_layer_C	0.001	54	165	91	220	S-layer like family, C-terminal region.
cd14948	BACON	0.009	736	795	26	81	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT41413.1	0.0	15	990	4	979
QMW85894.1	0.0	15	990	4	979
AAO78620.1	0.0	15	990	4	979
QQA08355.1	0.0	15	990	4	979
ALJ44299.1	0.0	15	990	4	979

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZMH_A	3.42e-141	37	987	7	930	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
5BY3_A	7.83e-124	64	660	39	611	Anovel family GH115 4-O-Methyl-alpha-glucuronidase, BtGH115A, with specificity for decorated arabinogalactans [Bacteroides thetaiotaomicron VPI-5482]
4C90_A	1.26e-108	44	741	44	705	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
6NPS_A	6.43e-95	50	993	17	966	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]
7PUG_A	1.45e-93	91	668	63	629	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000967	0.998108	0.000427	0.000165	0.000151	0.000151

TMHMM  Annotations     

start	end
7	29