CAZyme Information: MGYG000001867_01429

Basic Information

• Species: CAG-873 sp900555715
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp900555715
• CAZyme ID: MGYG000001867_01429
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365		40365.13	10.4975

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001867	2424881	MAG	Denmark	Europe

• Gene Location: Start: 1044; End: 2141 Strand: +

Full Sequence      

MQAKSKASPQGNSRGLRSVLLARFSALGDVAMTVPVIFSACRTYPDVRFVLVTRPSMTSI
FLNAPSNLTVVGVDLRTRYDGIAGIRRLVGELVDEYRPDMFIDLHNVLRTKLMAAFLRLR
GIPTERIFKPRAKRRALTRRNNKVMLPLISQRARYREAFFKAGLAVTDSFGGLFGGRAKA
DAADFSAITAPKPAGERWVGIAPFAAHDGKVYPPEMMGEVVAMLDRESRQFPMRVFLFGG
GAHEAEILGAWANKYPSVTSLAGKKYGFPAELALLNHLDVLVSMDSANMHLGAIAQAPTV
SIWGATHPYCGFKGWRQTDADTIQLPMSCRPCSVFGDKPCYRGDKLCLRAIKPQMIFEKI
KEHLQ

Enzyme Prediction     

No EC number prediction in MGYG000001867_01429.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	89	340	1.9e-31	0.9377777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	1.09e-37	18	362	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	4.18e-34	17	362	2	328	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	2.30e-13	86	308	1	214	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	2.38e-06	17	325	6	306	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD37124.1	2.94e-133	17	361	3	343
QQR08225.1	2.10e-128	9	365	2	353
ANU64408.1	2.10e-128	9	365	2	353
ASB37493.1	2.10e-128	9	365	2	353
AHF12543.1	1.88e-106	17	362	4	344

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.956626	0.041604	0.001527	0.000086	0.000056	0.000103

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001867_01429.