CAZyme Information: MGYG000001867_01772

Basic Information

• Species: CAG-873 sp900555715
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp900555715
• CAZyme ID: MGYG000001867_01772
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
292		33627.65	9.3082

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001867	2424881	MAG	Denmark	Europe

• Gene Location: Start: 484; End: 1362 Strand: -

Full Sequence      

MSALFNAAKLAIIQLITKHFQKYFRTSFFLYNFASDIYSTRLMIPKKIHYCWFGHNPLPK
SAIKCIESWKKFLPDYEIVEWNEENFDIGAIAYTAQAYQVGKYAFVSDYARFKILYDNGG
LYFDTDVELIAPIDDIIENGNFMGFETDCGEKTGEVNPGLGLGTSKGNPIYKDILDYYSG
LKFIKPDGTLETTTIVIHTTDVLRRHGLRNVPGIQKVGDISIYPVEYFNPFDWKTGLPQT
TPNSRSIHWYAKTWVSPGRRFYQKFKYFANRLLGKRTVAFIKKMVGLEGKHT

Enzyme Prediction     

No EC number prediction in MGYG000001867_01772.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	64	138	8.5e-21	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	2.18e-18	37	176	75	212	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	2.43e-14	59	142	1	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	1.64e-09	41	142	43	149	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	0.004	2	126	48	193	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK64207.1	6.56e-92	43	282	1	242
QUT53709.1	1.11e-86	43	266	1	225
AIN94379.1	2.87e-86	43	289	1	251
QRQ47479.1	4.46e-85	43	284	1	240
ALA75301.1	1.67e-82	43	260	1	221

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000024	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001867_01772.