CAZyme Information: MGYG000001868_00435

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000001868_00435
• CAZy Family: GH53
• CAZyme Description: Arabinogalactan endo-beta-1,4-galactanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352		39773.88	4.3684

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001868	1969203	MAG	Denmark	Europe

• Gene Location: Start: 8753; End: 9811 Strand: +

Full Sequence      

MNKIRFSNMRAKLALVFASVILNISIASADSFWLGGDISGVSADEARGRVFYDKDGNVAD
PFQLMRDAGMNSIRLRVWVDPTDGFCSPGDVTQMALRAQELGMPVMVDFHYSDWWADPGK
QNIPAAWKDMDLDEMCSALAEHTRSTLEELLANNIDVKWVQVGNETTHGFLWPMGRFEEN
PENYARLTQAGIDAVKEVYPDAQVIIHLDNGFDQDLYDRVFDSLLDNGVKWDMIGMSLYP
FWAMEGGFRPDEDSTLNDCIANIKHLKEKYGTDIMITEVGVDAREPEKGYDFMVKMFDKV
LDETDGACKGVYYWAPEINADADYHLGAFANDRPTKIMDSFRYAAEKAAKRK

Enzyme Prediction     

No EC number prediction in MGYG000001868_00435.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	35	320	4.4e-94	0.8918128654970761

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07745	Glyco_hydro_53	3.17e-92	35	323	3	304	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
COG3867	GanB	4.56e-83	28	317	35	343	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIF26228.1	2.31e-127	31	343	25	334
BCS85804.1	5.78e-123	12	341	3	333
AGB28883.1	4.03e-116	16	345	5	336
SCM59778.1	4.10e-106	32	342	39	359
QUT79100.1	4.82e-100	27	341	36	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GPA_A	1.65e-90	26	342	1	314	Beta-1,4-galactanasefrom Bacteroides thetaiotaomicron with galactose [Bacteroides thetaiotaomicron VPI-5482],6GPA_B Beta-1,4-galactanase from Bacteroides thetaiotaomicron with galactose [Bacteroides thetaiotaomicron VPI-5482]
6GP5_A	5.48e-90	26	342	37	350	Beta-1,4-galactanasefrom Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],6GP5_B Beta-1,4-galactanase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OSK_A	3.29e-47	38	314	51	352	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
4BF7_A	1.07e-45	24	316	12	315	Emericillanidulans endo-beta-1,4-galactanase [Aspergillus nidulans]
1R8L_A	3.66e-39	32	316	24	322	Thestructure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1D3T4	2.35e-50	9	316	1	321	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=galA PE=3 SV=1
Q0CTQ7	4.50e-48	26	332	11	328	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=galA PE=3 SV=1
B0XPR3	2.90e-47	9	316	1	321	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=galA PE=3 SV=2
Q4WJ80	1.12e-46	9	316	1	321	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=galA PE=3 SV=2
P48843	3.90e-46	30	316	4	310	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000756	0.997790	0.000593	0.000299	0.000275	0.000256

TMHMM  Annotations     

start	end
13	35