CAZyme Information: MGYG000001868_01474

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000001868_01474
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377		42525.35	9.6912

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001868	1969203	MAG	Denmark	Europe

• Gene Location: Start: 1588; End: 2721 Strand: +

Full Sequence      

MKYMIVAGEASGDLHGSRLIDAIKERDGEAEFCFFGGDRMAVAARHEPALHYDQLNVMGF
SEVLRSLPRLLRNLRKARRLMESERPDALVLVDFPGFNLKLAKAAKTLGIPVHYFISPKI
WAWKEYRIKAIRRYVDAMYCILPFEQDYYSRKHHYKAEYVGNPSVQEIDDEMRRVPSEKY
FRERYDITDPRPIIALLPGSRRGELRNNLPLMIAAAKRFPDYQYIVAAAPAQPERLYREI
AQDPGLKVVFGATHMLLRYSRAALVTSGTATLETALTGTPQVVCYRANGSPISYAIMAKL
LKVDYVSLPNLIANKEVVPELLVHKCTADSIAEHLSPLLAGSPERDKMLGGYKAVRKRLG
TNNAAERAATLIVDSLK

Enzyme Prediction     

No EC number prediction in MGYG000001868_01474.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	359	2e-119	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.55e-129	1	377	2	376	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	6.75e-124	1	377	2	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	9.85e-92	5	369	3	371	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.70e-82	5	374	10	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.88e-60	1	331	2	309	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36425.1	2.63e-137	1	376	1	374
QQR08529.1	6.31e-137	1	372	1	370
ASB37800.1	6.31e-137	1	372	1	370
ANU64105.1	6.31e-137	1	372	1	370
AHF12800.1	1.02e-119	1	377	1	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.58e-50	5	374	11	379	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	4.36e-50	5	374	11	379	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	4.55e-80	2	376	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
C1F718	5.58e-73	7	361	11	373	Lipid-A-disaccharide synthase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) OX=240015 GN=lpxB PE=3 SV=1
Q1INL4	6.70e-73	1	374	2	376	Lipid-A-disaccharide synthase OS=Koribacter versatilis (strain Ellin345) OX=204669 GN=lpxB PE=3 SV=1
Q2LVL8	1.68e-70	4	377	7	379	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q7NVY1	4.43e-68	1	374	8	381	Lipid-A-disaccharide synthase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) OX=243365 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001868_01474.