CAZyme Information: MGYG000001869_00034

Basic Information

• Species: HGM12619 sp900753195
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; UBA644; HGM12619; HGM12619 sp900753195
• CAZyme ID: MGYG000001869_00034
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
229		25333.12	9.7359

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001869	1750418	MAG	Denmark	Europe

• Gene Location: Start: 39341; End: 40030 Strand: -

Full Sequence      

MAEARKKKRTGRTILVIFAVIAGIIIISAATIFGIGYGMYKRAVSALPAEQVYLTASSQE
GYVTLDRISPDLQAAVIAIEDHRFYSHPGYDIRSMCRAAVDSIITGNLTGGSTITQQTAK
NVWFTQEKRFTRKAAEIFAARDLERVLGKEKILELYLNISFFGKGSYGIGAAAREFFGTT
PDKLTLEQSVYLAGLLQAPSVYSANEEKAAQRYEKVVNAMKRYNMYPSD

Enzyme Prediction     

No EC number prediction in MGYG000001869_00034.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	56	221	5e-58	0.9491525423728814

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	1.16e-68	62	221	15	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	1.81e-56	62	226	78	246	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	3.48e-51	62	220	69	230	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK00056	mtgA	2.89e-42	39	205	41	206	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	5.33e-39	39	220	36	218	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHS24352.1	4.76e-53	25	223	15	215
AZV41456.1	1.20e-52	24	223	14	217
QOR67159.1	5.61e-51	9	223	10	217
QNM12078.1	1.13e-47	34	222	24	215
BBK21420.1	8.73e-47	32	223	22	216

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZZK_A	2.14e-33	58	224	55	230	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	2.35e-33	58	224	19	194	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	2.42e-33	58	224	20	195	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]
3VMQ_A	3.20e-33	58	224	72	247	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMQ_B Chain B, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMR_A Chain A, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMS_A Chain A, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMS_B Chain B, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMT_A Chain A, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMT_B Chain B, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3NB6_A	5.73e-32	48	220	7	183	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q07259	1.04e-33	15	220	11	209	Putative transglycosylase H16_A0665 OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=H16_A0665 PE=3 SV=2
A5IU40	1.02e-32	58	224	78	253	Monofunctional glycosyltransferase OS=Staphylococcus aureus (strain JH9) OX=359786 GN=mgt PE=3 SV=1
A6U2X8	1.02e-32	58	224	78	253	Monofunctional glycosyltransferase OS=Staphylococcus aureus (strain JH1) OX=359787 GN=mgt PE=3 SV=1
Q2YU13	2.01e-32	58	224	78	253	Monofunctional glycosyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) OX=273036 GN=mgt PE=3 SV=1
Q5HEQ0	2.01e-32	58	224	78	253	Monofunctional glycosyltransferase OS=Staphylococcus aureus (strain COL) OX=93062 GN=mgt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.831967	0.068921	0.006721	0.001174	0.000432	0.090791

TMHMM  Annotations     

start	end
13	35