CAZyme Information: MGYG000001870_00615

Basic Information

• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium
• CAZyme ID: MGYG000001870_00615
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
203	MGYG000001870_7|CGC2	24093.74	7.9451

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001870	1979234	MAG	Denmark	Europe

• Gene Location: Start: 12164; End: 12775 Strand: +

Full Sequence      

MARRKKKKLLDRWTVKFLLVAIAFFIIGEAGIKIWNSEAVQTRFVYMWPYQEEILEYSAK
NKIDPFLVAAVIKNESGFDTEAVSHAGAIGLMQIMPETGAWIASQMGLEFDFDALHTPEY
NVRLGCWYLGELEYEFQRNWVLMMIAYNAGRGNTRAWMQENGWNYDFNRIEDIPYPDTRE
YVKKVLRDRDKYYLFYKNKIKNY

Enzyme Prediction     

No EC number prediction in MGYG000001870_00615.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	57	191	1.7e-29	0.8518518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	9.39e-75	48	191	2	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	3.57e-56	49	197	5	150	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	2.12e-37	65	187	1	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	4.10e-31	49	203	138	294	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	1.74e-24	54	163	1	108	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBG64618.1	5.94e-103	1	203	1	201
QNP77119.1	3.36e-100	13	203	26	212
QTV76946.1	2.48e-89	2	201	7	206
ADB46849.1	5.24e-68	18	203	13	199
AEQ23289.1	4.76e-66	6	192	2	189

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	4.35e-24	46	186	412	549	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	4.37e-24	46	186	416	553	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	4.42e-24	46	186	422	559	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	4.44e-24	46	186	426	563	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	4.48e-24	46	186	432	569	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	4.23e-16	60	185	70	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P0AGC4	1.87e-15	33	196	467	628	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	1.87e-15	33	196	467	628	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P39434	4.66e-15	33	193	467	625	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O31976	1.02e-14	46	191	1418	1543	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.992142	0.007514	0.000068	0.000017	0.000015	0.000264

TMHMM  Annotations     

start	end
13	35